KEGG   Homo sapiens (human): 10844
Entry
10844             CDS       T01001                                 

Gene name
TUBGCP2, ALP4, GCP-2, GCP2, Grip103, PAMDDFS, SPBC97, SPC97, Spc97p, h103p, hGCP2, hSpc97
Definition
(RefSeq) tubulin gamma complex associated protein 2
  KO
K16569  gamma-tubulin complex component 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10844 (TUBGCP2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10844 (TUBGCP2)
   04147 Exosome [BR:hsa04147]
    10844 (TUBGCP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     10844 (TUBGCP2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     10844 (TUBGCP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10844 (TUBGCP2)
SSDB
Motif
Pfam: GCP_C_terminal GCP_N_terminal zf-Tim10_DDP Chorismate_bind
Other DBs
NCBI-GeneID: 10844
NCBI-ProteinID: NP_006650
OMIM: 617817
HGNC: 18599
Ensembl: ENSG00000130640
Vega: OTTHUMG00000019319
Pharos: Q9BSJ2(Tbio)
UniProt: Q9BSJ2 Q53EQ3
Position
10q26.3
AA seq 902 aa
MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTP
EDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSI
NVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAW
VYERPALIGDFLIGAGISTDTALPIGTLPLASQESAVVEDLLYVLVGVDGRYVSAQPLAG
RQSRTFLVDPNLDLSIRELVHRILPVAASYSAVTRFIEEKSSFEYGQVNHALAAAMRTLV
KEHLILVSQLEQLHRQGLLSLQKLWFYIQPAMRTMDILASLATSVDKGECLGGSTLSLLH
DRSFSYTGDSQAQELCLYLTKAASAPYFEVLEKWIYRGIIHDPYSEFMVEEHELRKERIQ
EDYNDKYWDQRYTIVQQQIPSFLQKMADKILSTGKYLNVVRECGHDVTCPVAKEIIYTLK
ERAYVEQIEKAFNYASKVLLDFLMEEKELVAHLRSIKRYFLMDQGDFFVHFMDLAEEELR
KPVEDITPPRLEALLELALRMSTANTDPFKDDLKIDLMPHDLITQLLRVLAIETKQEKAM
AHADPTELALSGLEAFSFDYIVKWPLSLIINRKALTRYQMLFRHMFYCKHVERQLCSVWI
SNKTAKQHSLHSAQWFAGAFTLRQRMLNFVQNIQYYMMFEVMEPTWHILEKNLKSASNID
DVLGHHTGFLDTCLKDCMLTNPELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTL
EHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHLLDLLARL
SIYSTSDCEHGMASVISRLDFNGFYTERLERLSAERSQKATPQVPVLRGPPAPAPRVAVT
AQ
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgagtgaatttcggattcaccatgacgtcaatgaactgcttagcctgctgcgtgtccac
ggaggagatggggctgaggtctacattgacctgcttcaaaagaacaggaccccgtacgtc
actaccactgtctctgctcacagtgccaaggttaaaattgcagagttttctcgtactcca
gaagactttctaaagaaatatgatgaactgaaatctaaaaatacaaggaaccttgacccg
ctggtgtacctgttgtcaaagctcacggaagacaaagagactctgcagtacttacaacag
aatgcaaaagaaagagctgagcttgcagccgctgctgtgggcagcagtaccaccagcatc
aacgtccctgccgcggcctccaagatctccatgcaggagcttgaggaactgaggaagcag
cttggcagcgtggccacaggctccacgctgcagcagtctctggaacttaaaagaaagatg
cttcgagacaagcagaacaaaaaaaattcaggccagcacctccccatcttcccagcatgg
gtgtatgagagacctgccctgatcggggatttcctgattggtgctggcatcagcacagac
accgctttgccgataggcacgttgcccctggcctcgcaggagtcggccgtggtggaggac
ctgctgtacgtgctggtgggcgtggacgggaggtacgtcagtgctcagcccctggctggg
aggcagagccggaccttcctcgtggaccccaacctggacctgtccatcagggagctggtg
cacaggatcctcccagtggccgccagctactccgctgtgaccaggttcattgaagagaag
tcttccttcgagtacgggcaggtgaaccacgccctggcggccgccatgcgcaccctggtg
aaggagcacctgattctggtgtcacagctggagcagctgcacaggcagggcctcctttcg
ctgcagaagctctggttctacatccagccagccatgcgcaccatggacatcctggcctcc
ctcgccacctcggtggacaaaggcgaatgtcttggggggtccacgctgagcctgctccac
gacaggagcttcagctacacaggggacagccaggcgcaggagctatgcctgtacctaacc
aaggcggccagtgctccctacttcgaggttctggagaagtggatctacaggggcatcatc
cacgacccatacagtgagtttatggtcgaggagcacgagctgcggaaggagaggatccag
gaggattacaacgacaagtactgggaccagcggtacaccatcgtccagcagcagatcccg
tccttcctgcagaaaatggcggacaagatcctcagcacaggaaaatatctaaatgtggtc
agagagtgtggccatgacgtcacctgcccggtggctaaagagatcatctacacgttaaaa
gagcgggcgtatgtggagcagatcgagaaggcgtttaactacgccagcaaggtgctgctg
gacttcctgatggaggagaaggagctggtggctcacctcaggtccatcaagcgctacttc
ctcatggaccagggcgacttcttcgtgcacttcatggacctcgcggaggaggagctccgg
aagccggtggaggacatcacgccccctcgcctggaagcgctcctggagctggcgctgcgc
atgagcacggccaacactgaccccttcaaggacgacctcaagatcgacctgatgccccat
gacctcatcactcagctcttgcgcgtcctggccatcgagaccaagcaggagaaggcgatg
gcgcacgccgaccccacggagctggcgctgagcggcctggaggccttctctttcgactac
atcgtcaagtggcccctttcgctcatcatcaacaggaaagccctcactcgctaccagatg
ctcttcaggcacatgttctactgcaagcacgtggagcggcagctctgcagcgtctggatc
agcaacaaaaccgccaagcagcactcgctgcactccgcccagtggtttgctggggctttc
actctgcggcagcgaatgctcaacttcgtccagaatattcaatactacatgatgtttgaa
gtgatggaaccgacctggcacatcctggagaaaaacctgaaatccgcctccaacattgac
gacgtccttggccaccacacaggcttcctggacacctgcctgaaggactgcatgctcacc
aaccccgagctgctgaaggtcttctccaagctcatgtctgtgtgcgtcatgttcaccaac
tgcatgcagaaatttacacagagcatgaaattagatggcgagctgggcgggcagacgctg
gagcacagcaccgtcctggggctgcccgcaggggccgaggagcgggcccggaaggagctc
gccaggaagcacctggctgagcacgcagacactgtgcagctggtgtccggcttcgaggcc
accatcaacaagtttgacaagaacttctcagcccacctgctggacctcctggcccggctg
agcatctatagcaccagtgactgtgagcacggcatggccagcgtcatctccaggcttgac
ttcaatggtttctacacggagcgcctggagcgcctgtctgcagagaggagccagaaggcc
accccccaagtgcctgtcctgcgggggcccccggctcctgcacccagggtcgcagtcacc
gcacagtga

DBGET integrated database retrieval system