KEGG   Homo sapiens (human): 10845Help
Entry
10845             CDS       T01001                                 

Gene name
CLPX, EPP2
Definition
(RefSeq) caseinolytic mitochondrial matrix peptidase chaperone subunit
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10845 (CLPX)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP100
   10845 (CLPX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_2 ClpB_D2-small AAA AAA_5 Sigma54_activat AAA_7 Mg_chelatase AAA_22 Sigma54_activ_2 AAA_16 RuvB_N AAA_14 IstB_IS21 T2SSE TsaE NACHT MCM AAA_24 ABC_tran AAA_18 TIP49 AAA_29 PduV-EutP RNA_helicase
Motif
Other DBs
NCBI-GeneID: 10845
NCBI-ProteinID: NP_006651
OMIM: 615611
HGNC: 2088
Ensembl: ENSG00000166855
Vega: OTTHUMG00000133139
Pharos: O76031(Tbio)
UniProt: O76031 A0A024R5X7
Position
15q22.31
AA seq 633 aa AA seqDB search
MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTET
PAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVS
STRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKYV
VGQSFAKKVLSVAVYNHYKRIYNNIPANLRQQAEVEKQTSLTPRELEIRRREDEYRFTKL
LQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHDDIKLEKSNILLLGPTGSGKT
LLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEV
DKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVAS
GAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLR
HVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCEL
NVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEP
GYIRAPTKESSEEEYDSGVEEEGWPRQADAANS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcccagctgcggtgcttgtacttgcggcgcggcggccgtccggctcatcacctcctca
ctcgcctccgcgcagagaggtatttctggtggtcgcattcatatgtcagttttaggaagg
cttgggacatttgaaactcagattctgcaaagagctcctcttagatcctttacagaaaca
ccagcatactttgcctcaaaagatgggataagtaaagatggttctggagatggaaataag
aaatcagcaagtgagggaagtagtaagaaatcaggctctgggaattctgggaaaggtgga
aaccagctgcgctgtcctaaatgtggcgacttgtgcacacatgtagagacctttgtatca
tccacccgttttgtcaagtgtgaaaagtgtcatcatttttttgttgtgctatctgaagca
gactcaaagaaaagcataattaaagaacctgaatcagcagcagaagctgtaaaattggca
ttccaacagaaaccaccacctccccctaagaagatttataactacctcgacaagtatgtt
gttggccagtcatttgctaagaaggtgctttcagttgctgtgtacaatcattataagaga
atatataataatatcccagctaatctgagacagcaagcagaggttgagaagcagacatca
ttaacaccaagagagttagaaataagaagacgggaggatgagtacagatttacaaaattg
cttcagattgctggaattagcccacatggtaatgctttaggagcatcaatgcagcaacag
gtaaatcaacaaatacctcaggaaaaacgaggaggtgaagtattggattcttctcatgat
gacataaaacttgaaaaaagtaatattttgctgcttggaccaactgggtcaggtaaaact
ctgctggcacaaaccctagctaaatgccttgatgtcccttttgctatctgtgactgtaca
actttgactcaggctggatatgtaggcgaagatattgaatctgtgattgcaaaactactc
caagatgccaattataatgtggaaaaagcacaacaaggaattgtctttctggatgaagta
gataagattggcagtgtgccaggcattcatcaattacgggatgtaggtggagaaggcgtt
cagcaaggcttattaaaactactagaaggcacaatagtcaatgttccagaaaagaattcc
cgaaagctccgtggagaaacagttcaagttgatacaacaaacatcctgtttgtggcatct
ggtgctttcaatggtttagacagaatcatcagcaggaggaaaaatgaaaagtatcttgga
tttggaacaccatctaatctgggaaaaggcagaagggctgcagctgctgcagaccttgct
aatcgaagtggggaatcgaatactcaccaagacattgaagaaaaagatcggttattgcgt
catgtggaagccagagatctgattgagtttggcatgattcctgagtttgtgggacggttg
cctgtggtggttccattgcatagcctagatgagaaaacacttgtacaaatattaactgag
ccacgaaatgctgttattcctcagtaccaggccttattcagcatggataagtgtgaactg
aatgttactgaggatgctttgaaagctatagccagattggcactagaacgaaaaacaggt
gcacgaggccttcggtccataatggaaaagctgttactagaaccaatgtttgaagtccct
aattctgatatcgtatgtgtggaggttgacaaagaagtagtagaaggaaaaaaggaacca
ggatacatccgggctccaacaaaagaatcctctgaagaggagtatgactctggagttgaa
gaagaaggatggccccgccaagcagatgctgcaaacagctaa

DBGET integrated database retrieval system