KEGG   Homo sapiens (human): 10846Help
Entry
10846             CDS       T01001                                 

Gene name
PDE10A, ADSD2, HSPDE10A, IOLOD, LINC00473, PDE10A19
Definition
(RefSeq) phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa05032  Morphine addiction
Disease
H01570  Autosomal dominant striatal degeneration
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Balipodect: D11245
Bemoradan: D03075
Bucladesine (DG00230): D01238 D07546
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Mardepodect: D11171
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Trapidil: D01220
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    10846 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10846 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    10846 (PDE10A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     10846 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     10846 (PDE10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N DUF4748
Motif
Other DBs
NCBI-GeneID: 10846
NCBI-ProteinID: NP_006652
OMIM: 610652
HGNC: 8772
Ensembl: ENSG00000112541
Vega: OTTHUMG00000015986
Pharos: Q9Y233(Tclin)
UniProt: Q9Y233 A0A1B1UZR0
Structure
PDB: 

Position
6q27
AA seq 779 aa AA seqDB search
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagaagagaggaaatcccaacatttaacaggtttgacagatgaaaaagtgaag
gcatatctttctcttcacccccaggtattagatgaatttgtatctgaaagtgttagtgca
gagacagtagagaaatggctgaagaggaagaacaacaaatcagaagatgaatcagctcct
aaggaagtcagcaggtaccaagatacgaatatgcagggagttgtatatgaactaaacagc
tatatagaacaacggttggacacaggaggagacaaccagctactcctctatgaactgagc
agcatcattaaaatagccacaaaagccgatggatttgcactgtatttccttggagagtgc
aataatagcctgtgtatattcacgccacctgggataaaggaaggaaaaccccgcctcatc
cctgctgggcccatcactcagggcaccaccgtctctgcttatgtggccaagtccaggaaa
acactgctagtagaagacatccttggagatgaacgatttccaagaggtactggactggaa
tcagggactcgtatccagtctgttctttgcttaccaattgtcactgcaattggtgacttg
attggtattctcgagctgtatcggcactggggcaaagaagccttctgtcttagtcaccag
gaggttgcaacagcaaatcttgcctgggcttcagtagcaatacatcaggtgcaggtatgc
agaggccttgccaaacagacagaattgaatgacttcctactcgacgtatcaaaaacatat
tttgataacatagttgcaatagattctctacttgaacacataatgatatatgcaaaaaac
ctggtgaatgccgatcgttgtgcgcttttccaggtggaccataagaacaaggagttatat
tcagacctttttgatattggagaggaaaaggaaggaaaacctgtcttcaagaagaccaaa
gagataagattttcaattgagaaaggaattgctggccaagtagcaagaacaggggaagtc
ctgaacattccagatgcctatgcagacccacgctttaacagagaagtagacttgtacaca
ggctacaccacgcggaacatcctgtgcatgcccatcgtcagccgaggcagcgtgataggt
gtggtgcagatggtcaacaaaatcagtggcagtgccttctctaaaacagatgaaaacaac
ttcaaaatgtttgccgtcttttgtgctttagccttacactgtgctaatatgtatcataga
attcgccactcagagtgcatttaccgggtaacgatggaaaagctgtcctaccatagcatt
tgtacttcagaagagtggcaaggtctcatgcaattcacccttcccgtgcgtctctgcaaa
gaaattgaattattccactttgacattggtccttttgaaaacatgtggcctggaattttt
gtctacatggttcatcggtcctgtgggacatcctgctttgagcttgaaaagttgtgtcgt
tttattatgtctgtgaagaagaactatcggcgggttccttatcacaactggaagcatgcg
gtcactgtagcacactgcatgtatgccatacttcagaacaatcacacgcttttcacagac
cttgagcgcaaaggactgctgattgcgtgtctgtgtcatgacctggaccacaggggcttc
agtaacagctacctgcagaagttcgaccaccctctggccgctctctactccacttccacc
atggagcagcaccacttctcccagactgtgtccatcctccagttggaagggcacaatatc
ttctccactctgagctccagtgaatatgagcaggtgcttgagatcatccgcaaagccatc
attgccacagaccttgctttatactttggaaacaggaagcagttggaagagatgtaccag
accggatcactaaaccttaataatcaatcacatagagaccgtgtaattggtttgatgatg
actgcctgtgacctttgttctgtgacaaaactgtggcccgttacaaaattgacggcaaat
gatatatatgcagaattctgggctgagggtgatgaaatgaagaaattgggaatacagcct
attcctatgatggacagagacaagaaggatgaagtcccccaaggccagcttgggttctac
aatgccgtggccattccctgctatacaacccttacccagatcctccctcccacggagcct
cttctgaaagcatgcagggataatctcagtcagtgggagaaggtgattcgaggggaggag
actgcaacctggatttcatccccatccgtggctcagaaggcagctgcatctgaagattga

DBGET integrated database retrieval system