KEGG   Homo sapiens (human): 10850Help
Entry
10850             CDS       T01001                                 

Gene name
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Definition
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10850 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10850 (CCL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10850 (CCL27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 10850
NCBI-ProteinID: NP_006655
OMIM: 604833
HGNC: 10626
Ensembl: ENSG00000213927
Vega: OTTHUMG00000019834
Pharos: Q9Y4X3(Tbio)
UniProt: Q9Y4X3 Q5VZ77
Structure
PDB: 

Position
9p13.3
AA seq 112 aa AA seqDB search
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

DBGET integrated database retrieval system