KEGG   Homo sapiens (human): 10857Help
Entry
10857             CDS       T01001                                 

Gene name
PGRMC1, Dap1, HPR6.6, IZA, MPR
Definition
(RefSeq) progesterone receptor membrane component 1
  KO
K17278  membrane-associated progesterone receptor component
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10857 (PGRMC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   10857 (PGRMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyt-b5 Tr-sialidase_C
Motif
Other DBs
NCBI-GeneID: 10857
NCBI-ProteinID: NP_006658
OMIM: 300435
HGNC: 16090
Ensembl: ENSG00000101856
Vega: OTTHUMG00000022268
Pharos: O00264(Tbio)
UniProt: O00264 Q6IB11
Structure
PDB: 

Position
Xq24
AA seq 195 aa AA seqDB search
MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVY
SDEEEPKDESARKND
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggatgtggtggcgactggcgccgacccaagcgatctggagagcggcggg
ctgctgcatgagattttcacgtcgccgctcaacctgctgctgcttggcctctgcatcttc
ctgctctacaagatcgtgcgcggggaccagccggcggccagcggcgacagcgacgacgac
gagccgccccctctgccccgcctcaagcggcgcgacttcacccccgccgagctgcggcgc
ttcgacggcgtccaggacccgcgcatactcatggccatcaacggcaaggtgttcgatgtg
accaaaggccgcaaattctacgggcccgaggggccgtatggggtctttgctggaagagat
gcatccaggggccttgccacattttgcctggataaggaagcactgaaggatgagtacgat
gacctttctgacctcactgctgcccagcaggagactctgagtgactgggagtctcagttc
actttcaagtatcatcacgtgggcaaactgctgaaggagggggaggagcccactgtgtac
tcagatgaggaagaaccaaaagatgagagtgcccggaaaaatgattaa

DBGET integrated database retrieval system