KEGG   Homo sapiens (human): 10863
Entry
10863             CDS       T01001                                 

Gene name
ADAM28, ADAM_28, MDC-L, MDCL, eMDC_II, eMDCII
Definition
(RefSeq) ADAM metallopeptidase domain 28
  KO
K08614  disintegrin and metalloproteinase domain-containing protein 28 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10863 (ADAM28)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     10863 (ADAM28)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   10863 (ADAM28)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 7tm_1 EphA2_TM YajC
Other DBs
NCBI-GeneID: 10863
NCBI-ProteinID: NP_055080
OMIM: 606188
HGNC: 206
Ensembl: ENSG00000042980
Vega: OTTHUMG00000163780
Pharos: Q9UKQ2(Tbio)
UniProt: Q9UKQ2
Position
8p21.2
AA seq 775 aa
MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYK
MTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDAS
ISTCRGLRGYFSQGDQRYFIEPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDL
QQNIALPATKLVKLKDRKVQEHEKYIEYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNM
LYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATE
LAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTI
CVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNG
KSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSK
YGYCRRVDDTLIPCKANDTMCGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMV
ANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSS
VVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQRPLSTTGTRPHKQKRKPQMVK
AVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKDSNPKA
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgttgcaaggtctcctgccagtcagtctcctcctctctgttgcagtaagtgctataaaa
gaactccctggggtgaagaagtatgaagtggtttatcctataagacttcatccactgcat
aaaagagaggccaaagagccagagcaacaggaacaatttgaaactgaattaaagtataaa
atgacaattaatggaaaaattgcagtgctttatttgaaaaaaaacaagaacctccttgca
ccaggctacacggaaacatattataattccactggaaaggagatcaccacaagcccacaa
attatggatgattgttattatcaaggacatattcttaatgaaaaggtttctgacgctagc
atcagcacatgtaggggtctaaggggctacttcagtcagggggatcaaagatactttatt
gaacctttaagccccatacatcgggatggacaggagcatgcactcttcaagtataaccct
gatgaaaagaattatgacagcacctgtgggatggatggtgtgttgtgggcccacgatttg
cagcagaacattgccctacctgccaccaaactagtaaaattgaaagacaggaaggttcag
gaacatgagaaatacatagaatattatttggtcctggataatggtgagtttaaaaggtac
aatgagaatcaagatgagatcagaaagagggtatttgagatggctaattatgtcaacatg
ctttataaaaagctcaatactcatgtggccttagttggtatggaaatctggactgacaag
gataagataaagataaccccaaatgcaagcttcaccttggagaatttttctaaatggagg
gggagtgttctctcaagaagaaagcgtcatgatattgctcagttaatcacagcaacagaa
cttgctggaacgactgtgggtcttgcatttatgtctacaatgtgttctccttattctgtt
ggcgttgttcaggaccacagcgataatcttcttagagttgcagggacaatggcacatgaa
atgggccacaactttggaatgtttcatgacgactattcttgcaagtgtccttctacaata
tgtgtgatggacaaagcactgagcttctatatacccacagacttcagttcctgcagccgt
ctcagctatgacaagttttttgaagataaattatcaaattgcctctttaatgctccattg
cctacagatatcatatccactccaatttgtgggaaccagttggtggaaatgggagaggac
tgtgattgtgggacatctgaggaatgtaccaatatttgctgtgatgctaagacatgtaaa
atcaaagcaacttttcaatgtgcattaggagaatgttgtgaaaaatgccaatttaaaaag
gctgggatggtgtgcagaccagcaaaagatgagtgcgacctgcctgaaatgtgtaatggt
aaatctggtaattgtcctgatgatagattccaagtcaatggcttcccttgccatcacggg
aagggccactgcttgatggggacatgccccacactgcaggagcagtgcacagagctgtgg
ggaccaggaactgaggttgcagataagtcatgttacaacaggaatgaaggtgggtcaaag
tacgggtactgtcgcagagtggatgacacactcattccctgcaaagcaaatgataccatg
tgtgggaagttgttctgtcaaggtgggtcggataatttgccctggaaaggacggatagtg
actttcctgacatgtaaaacatttgatcctgaagacacaagtcaagaaataggcatggtg
gccaatggaactaagtgtggcgataacaaggtttgcattaatgcagaatgtgtggatatt
gagaaagcctacaaatcaaccaattgctcatctaagtgcaaaggacatgctgtgtgtgac
catgagctccagtgtcaatgtgaggaaggatggatccctcccgactgcgatgactcctca
gtggtcttccacttctccattgtggttggggtgctgttcccaatggcggtcatttttgtg
gtggttgctatggtaatccggcaccagagctccagagaaaagcagaagaaagatcagagg
ccactatctaccactggcaccaggccacacaaacagaagaggaaaccccagatggtaaag
gctgttcaaccccaagagatgagtcagatgaagccccatgtgtatgatctgccagtagaa
ggcaatgagcccccagcctcttttcataaagacacaaacgcacttccccctactgttttc
aaggataatccagtgtctacacctaaggactcaaatccaaaagcatga

DBGET integrated database retrieval system