KEGG   Homo sapiens (human): 10864Help
Entry
10864             CDS       T01001                                 

Gene name
SLC22A7, NLT, OAT2, hOAT11
Definition
(RefSeq) solute carrier family 22 member 7
  KO
K08204  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    10864 (SLC22A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   10864 (SLC22A7)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    10864 (SLC22A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2
Motif
Other DBs
NCBI-GeneID: 10864
NCBI-ProteinID: NP_696961
OMIM: 604995
HGNC: 10971
Ensembl: ENSG00000137204
Vega: OTTHUMG00000014726
Pharos: Q9Y694(Tbio)
UniProt: Q9Y694
Position
6p21.1
AA seq 548 aa AA seqDB search
MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSH
QDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYD
HSEFSSTIATESQWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYV
STLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFW
TGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLH
CARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFS
YYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLA
PLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
MPMKQVQN
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgaggagctgctggagcaggtgggcggctttgggcccttccaactgcggaat
gtggcactgctggccctgccccgagtgctgctaccactgcacttcctcctgcccatcttc
ctggctgccgtgcctgcccaccgatgtgccctgccgggtgcccctgccaacttcagccat
caggatgtgtggctggaggcccatcttccccgggagcctgatggcacgctcagctcctgc
ctccgctttgcctatccccaggctctccccaacaccacgttgggggaagaaaggcagagc
cgtggggagctggaggatgaacctgccacagtgccctgctctcagggctgggagtacgac
cactcagaattctcctctaccattgcaactgagtcccagtgggatctggtgtgtgagcag
aaaggtctgaacagagctgcgtccactttcttcttcgccggtgtgctggtgggggctgtg
gcctttggatatctgtccgacaggtttgggcggcggcgtctgctgctggtagcctacgtg
agtaccctggtgctgggcctggcatctgcagcctccgtcagctatgtaatgtttgccatc
acccgcacccttactggctcagccctggctggttttaccatcatcgtgatgccactggag
ctggagtggctggatgtggagcaccgcaccgtggctggagtcctgagcagcaccttctgg
acagggggcgtgatgctgctggcactggttgggtacctgatacgggactggcgatggctt
ctgctagctgtcaccctgccttgtgccccaggcatcctcagcctctggtgggtgcctgag
tctgcacgctggcttctgacccaaggccatgtgaaagaggcccacaggtacttgctccac
tgtgccaggctcaatgggcggccagtgtgtgaggacagcttcagccaggaggctgtgagc
aaagtggccgccggggaacgggtggtccgaagaccttcatacctagacctgttccgcaca
ccacggctccgacacatctcactgtgctgcgtggtggtgtggttcggagtgaacttctcc
tattacggcctgagtctggatgtgtcggggctggggctgaacgtgtaccagacacagctg
ttgttcggggctgtggaactgccctccaagctgctggtctacttgtcggtgcgctacgca
ggacgccgcctcacgcaagccgggacactgctgggcacggccctggcgttcggcactaga
ctgctagtgtcctccgatatgaagtcctggagcactgtcctggcagtgatggggaaagct
ttttctgaagctgccttcaccactgcctacctgttcacttcagagttgtaccctacggtg
ctcagacagacagggatggggctgactgcactggtgggccggctggggggctctttggcc
ccactggcggccttgctggatggagtgtggctgtcactgcccaagcttacttatgggggg
atcgccctgctggctgccggcaccgccctcctgctgccagagacgaggcaggcacagctg
ccagagaccatccaggacgtggagagaaagagtgccccaaccagtcttcaggaggaagag
atgcccatgaagcaggtccagaactaa

DBGET integrated database retrieval system