KEGG   Homo sapiens (human): 10868
Entry
10868             CDS       T01001                                 

Gene name
USP20, LSFR3A, VDU2, hVDU2
Definition
(RefSeq) ubiquitin specific peptidase 20
  KO
K11848  ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10868 (USP20)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10868 (USP20)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     10868 (USP20)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   10868 (USP20)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    10868 (USP20)
SSDB
Motif
Pfam: UCH DUSP UCH_1 zf-UBP DNA_pol_phi CDC45
Other DBs
NCBI-GeneID: 10868
NCBI-ProteinID: NP_001008563
OMIM: 615143
HGNC: 12619
Ensembl: ENSG00000136878
Vega: OTTHUMG00000020793
Pharos: Q9Y2K6(Tbio)
UniProt: Q9Y2K6
Structure
PDB: 
6KCZ

Position
9q34.11
AA seq 914 aa
MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQ
PAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
LHGEQKIEAETRAV
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgggggactccagggacctttgccctcaccttgactccataggagaggtgaccaaagag
gacttgctgctcaaatctaagggaacctgtcagtcgtgtggggtcaccggaccaaaccta
tgggcctgtctgcaggttgcctgcccctatgttggctgcggagaatcctttgctgaccac
agcaccattcatgcacaggcaaaaaagcacaacttgaccgtgaacctgaccacgttccga
ctgtggtgttacgcctgtgagaaggaggtattcctggagcagcggctggcagcccctctg
ctgggctcctcttccaagttctctgaacaggactccccgccaccctcccaccctctgaaa
gctgttcctattgctgtggctgatgaaggagagtctgagtcagaggacgatgacctgaaa
cctcgaggcctcacgggcatgaagaacctcgggaactcctgctacatgaacgctgccctg
caggccctgtccaattgcccgccgctgactcagttcttcttggagtgtggcggcctggtg
cgcacagataagaagccagccctgtgcaagagctaccagaagctggtctctgaggtctgg
cataagaaacggccaagctacgtggtccccaccagtctgtctcatgggatcaagttggtc
aacccaatgttccgaggctatgcccagcaggacacccaagagttccttcgctgcctgatg
gaccagctgcacgaggagctcaaggagccggtggtggccacggtggcgctgacggaggct
cgggactcagattcgagtgacacggatgagaaacgggagggtgaccggagcccatcagaa
gatgagttcttgtcctgtgactcgagcagtgaccggggtgagggtgacgggcaggggcgt
ggcgggggcagctcgcaggccgagacggagctgctgatcccagatgaggcgggccgagcc
atctctgagaaggagcggatgaaggaccgcaagttctcctggggccagcagcgtacaaac
tcggagcaagtggacgaggacgctgatgtggacactgccatggctgcccttgacgaccag
cccgcggaggcccagcccccgtcaccacggtcctccagcccctgccggacgccagagccg
gacaatgatgctcacctacgcagctcctctcgcccctgcagccccgtccaccaccacgag
ggccatgccaagctgtctagcagcccccctcgtgcaagccccgtgaggatggcaccgtcg
tacgtgctcaagaaagcccaggtattgagtgctggcagccggaggcggaaggagcagcgc
taccgcagcgtcatctcagacatctttgacggctccattctcagccttgtgcagtgtctc
acctgtgaccgggtatccaccacagtggaaacgttccaggacttatcactgcccattcct
ggaaaggaggacctggccaagctccattcagccatctaccagaatgtgccggccaagcca
ggcgcctgtggggacagctatgccgcccagggctggctggccttcattgtggagtacatc
cgacggtttgtggtatcctgtacccccagctggttttgggggcctgtcgtcaccctggaa
gactgccttgctgccttctttgccgctgatgagttaaagggtgacaacatgtacagctgt
gagcggtgtaagaagctgcggaacggagtgaagtactgcaaagtcctgcggttgcccgag
atcctgtgcattcacctaaagcgctttcggcacgaggtgatgtactcattcaagatcaac
agccacgtctccttccccctcgaggggctcgacctgcgccccttccttgccaaggagtgc
acatcccagatcaccacctacgacctcctctcggtcatctgccaccacggcacggcaggc
agtgggcactacatcgcctactgccagaacgtgatcaatgggcagtggtacgagtttgat
gaccagtacgtcacagaagtccacgagacggtggtgcagaacgccgagggctacgtactc
ttctacaggaagagcagcgaggaggccatgcgggagcgacagcaggtggtgtccctggcc
gccatgcgggagcccagcctgctgcggttctacgtgtcccgcgagtggctcaacaagttc
aacaccttcgcggagccaggccccatcaccaaccagaccttcctctgctcccacggaggc
atcccgccccacaaataccactacatcgacgacctggtggtcatcctgccccagaacgtc
tgggagcacctgtacaacagattcgggggtggccccgccgtgaaccacctgtacgtgtgc
tccatctgccaggtggagatcgaggcactggccaagcgcaggaggatcgagatcgacacc
ttcatcaagttgaacaaggccttccaggccgaggagtcgccgggcgtcatctactgcatc
agcatgcagtggttccgggagtgggaggcgttcgtcaaggggaaggacaacgagcccccc
gggcccattgacaacagcaggattgcacaggtcaaaggaagcggccatgtccagctgaag
cagggagctgactacgggcagatttcggaggagacctggacctacctgaacagcctgtat
ggaggtggccccgagattgccatccgccagagtgtggcgcagccgctgggcccagagaac
ctgcacggggagcagaagatcgaagccgagacgcgggccgtgtga

DBGET integrated database retrieval system