KEGG   Homo sapiens (human): 10871Help
Entry
10871             CDS       T01001                                 

Gene name
CD300C, CLM-6, CMRF-35, CMRF-35A, CMRF35, CMRF35-A1, CMRF35A, CMRF35A1, IGSF16, LIR
Definition
(RefSeq) CD300c molecule
  KO
K06719  CD300 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10871 (CD300C)
CD molecules [BR:hsa04090]
 Proteins
  10871 (CD300C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3
Motif
Other DBs
NCBI-GeneID: 10871
NCBI-ProteinID: NP_006669
OMIM: 606786
HGNC: 19320
Ensembl: ENSG00000167850
Vega: OTTHUMG00000067608
Pharos: Q08708(Tbio)
UniProt: Q08708
Position
17q25.1
AA seq 224 aa AA seqDB search
MTARAWASWRSSALLLLLVPGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPP
QILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDF
HDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFS
NVRFLLLVLLELPLLLSMLGAVLWVNRPQRSSRSRQNWPKGENQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagggcctgggcctcgtggcggtcttcagctctgctcctcctgcttgtccca
ggctattttcctctgagccaccccatgaccgtggcgggccccgtggggggatccctgagt
gtgcagtgtcgctatgagaaggaacacaggaccctcaacaaattctggtgcagaccacca
cagattctccgatgtgacaagattgtggagaccaaagggtcagcagggaaaaggaatggc
cgagtgtccatcagggacagtcctgcaaacctcagcttcacagtgaccctggagaatctc
acagaggaggacgcaggcacctactggtgtggggtggatacaccgtggctccgagacttt
catgatcccattgtcgaggttgaggtgtccgtgttcccggccgggacgaccacagcctcc
agcccccagagctccatgggcacctcaggtcctcccacgaagctgcccgtgcacacctgg
cccagcgtgaccagaaaggacagccccgaacccagcccacaccctggctccctgttcagc
aatgtccgcttcctgctcctggtcctcttggagctgcccctgctcctgagcatgctgggt
gccgtcctctgggtgaacagacctcagagaagctctagaagcaggcagaattggcccaag
ggtgagaaccagtag

DBGET integrated database retrieval system