KEGG   Homo sapiens (human): 10873
Entry
10873             CDS       T01001                                 

Gene name
ME3, NADP-ME
Definition
(RefSeq) malic enzyme 3
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    10873 (ME3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    10873 (ME3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     10873 (ME3)
SSDB
Motif
Pfam: Malic_M malic
Other DBs
NCBI-GeneID: 10873
NCBI-ProteinID: NP_001014811
OMIM: 604626
HGNC: 6985
Ensembl: ENSG00000151376
Vega: OTTHUMG00000167217
Pharos: Q16798(Tbio)
UniProt: Q16798 Q6TCH8
Position
11q14.2
AA seq 604 aa
MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLN
KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI
KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRD
PLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA
EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGK
TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLST
IRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMN
VQTV
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgggtgccgcgctggggacaggcacgcggctggctccctggccgggccgggcctgcggc
gccctcccgcgctggacacccaccgcgcccgcccaaggctgccactccaagcctggcccg
gcgcgccctgtgcccctgaagaagcgcggatacgatgtcaccaggaaccctcatctcaac
aaggggatggcctttacccttgaagaaaggctgcagcttggaatccacggcctaatcccg
ccctgctttctgagccaggacgtccagctcctccgaatcatgagatattacgagcggcag
cagagtgacctggacaagtacatcattctcatgacactccaagaccggaacgagaagctc
ttctaccgagtgctgacttcggacgtggagaagttcatgccaatcgtgtacacgcctacc
gtggggctggcctgtcagcactatggcctgactttccgcaggccccgtggactgttcatc
accattcatgacaaaggtcatcttgcaacaatgctgaattcttggccagaagacaatatt
aaggccgtggtggtgactgatggggagcgcatcctgggcctgggagacctgggctgctac
ggcatgggcatccctgtgggcaagctggccctgtacacggcatgcggaggggtgaacccg
cagcagtgcctccctgtgctgctggacgtcggcaccaacaatgaggagctgctcagagac
cctctgtacatcggcctgaaacaccagcgcgtgcacgggaaggcatacgatgacttgctg
gatgagttcatgcaggctgtgacagacaagtttggaataaattgcctcatccaatttgaa
gacttcgccaatgccaatgccttccgcctgctcaacaaataccgtaacaagtactgcatg
ttcaatgatgacatccaaggcacagcctccgttgctgtggcagggatcttggctgctctg
cgaatcaccaagaacaagctttccaatcacgtgtttgttttccaaggtgcaggcgaggca
gctatgggcattgcccacctccttgtcatggccctagagaaagaaggtgtaccgaaggca
gaggccacaagaaagatctggatggtggactctaaagggctcattgtcaaggggaggagc
cacctgaaccatgaaaaggagatgtttgcccaagaccatcctgaagtcaactccctggag
gaggtggtgaggctggtgaagcccacagccatcataggtgttgctgccatcgcaggagcc
ttcacggagcagattctgagggacatggcctccttccacgagcgccctatcatctttgcc
ctgagcaaccccaccagcaaggccgagtgcacggctgagaagtgctaccgggtcaccgag
ggccgagggatttttgccagtggaagtccttttaagagtgtgactctggaagatggcaag
accttcattcctgggcagggaaacaatgcttacgtgttccccggggtggcactgggagtc
atcgccggcgggatccggcacatcccagatgagatcttcctcctgacagcagagcaaatt
gcccaggaagtctctgagcagcatctgtcccaggggagactctacccaccactcagcacc
atccgagacgtgtctttgagaattgccatcaaagttctcgactacgcgtacaaacacaac
ctggcttcctactacccagagcctaaggacaaggaggcttttgtaagatccctggtctac
actccagactatgactcctttacactggacagctacacttggcccaaggaagccatgaat
gttcagacggtctga

KEGG   Homo sapiens (human): 4199
Entry
4199              CDS       T01001                                 

Gene name
ME1, HUMNDME, MES
Definition
(RefSeq) malic enzyme 1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4199 (ME1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    4199 (ME1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4199 (ME1)
SSDB
Motif
Pfam: Malic_M malic Trimer_CC
Other DBs
NCBI-GeneID: 4199
NCBI-ProteinID: NP_002386
OMIM: 154250
HGNC: 6983
Ensembl: ENSG00000065833
Vega: OTTHUMG00000015111
Pharos: P48163(Tchem)
UniProt: P48163
Structure
PDB: 
2AW5 3WJA

Position
6q14.2
AA seq 572 aa
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
RGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLT
TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggagcccgaagccccccgtcgccgccacacccatcagcgcggctacctgctgacacgg
aaccctcacctcaacaaggacttggcctttaccctggaagagagacagcaattgaacatt
catggattgttgccaccttccttcaacagtcaggagatccaggttcttagagtagtaaaa
aatttcgagcatctgaactctgactttgacaggtatcttctcttaatggatctccaagat
agaaatgaaaaactcttttatagagtgctgacatctgacattgagaaattcatgcctatt
gtttatactcccactgtgggtctggcttgccaacaatatagtttggtgtttcggaagcca
agaggtctctttattactatccacgatcgagggcatattgcttcagttctcaatgcatgg
ccagaagatgtcatcaaggccattgtggtgactgatggagagcgtattcttggcttggga
gaccttggctgtaatggaatgggcatccctgtgggtaaattggctctatatacagcttgc
ggagggatgaatcctcaagaatgtctgcctgtcattctggatgtgggaaccgaaaatgag
gagttacttaaagatccactctacattggactacggcagagaagagtaagaggttctgaa
tatgatgattttttggacgaattcatggaggcagtttcttccaagtatggcatgaattgc
cttattcagtttgaagattttgccaatgtgaatgcatttcgtctcctgaacaagtatcga
aaccagtattgcacattcaatgatgatattcaaggaacagcatctgttgcagttgcaggt
ctccttgcagctcttcgaataaccaagaacaaactgtctgatcaaacaatactattccaa
ggagctggagaggctgccctagggattgcacacctgattgtgatggccttggaaaaagaa
ggtttaccaaaagagaaagccatcaaaaagatatggctggttgattcaaaaggattaata
gttaagggacgtgcttccttaacacaagagaaagagaagtttgcccatgaacatgaagaa
atgaagaacctagaagccattgttcaagaaataaaaccaactgccctcataggagttgct
gcaattggtggtgcattctcagaacaaattctcaaagatatggctgccttcaatgaacgg
cctattatttttgctttgagtaatccaactagcaaagcagaatgttctgcagagcagtgc
tacaaaataaccaagggacgtgcaatttttgccagtggcagtccttttgatccagtcact
cttccaaatggacagaccctatatcctggccaaggcaacaattcctatgtgttccctgga
gttgctcttggtgttgtggcgtgtggattgaggcagatcacagataatattttcctcact
actgctgaggttatagctcagcaagtgtcagataaacacttggaagagggtcggctttat
cctcctttgaataccattagagatgtttctctgaaaattgcagaaaagattgtgaaagat
gcataccaagaaaagacagccacagtttatcctgaaccgcaaaacaaagaagcatttgtc
cgctcccagatgtatagtactgattatgaccagattctacctgattgttattcttggcct
gaagaggtgcagaaaatacagaccaaagttgaccagtag

DBGET integrated database retrieval system