KEGG   Homo sapiens (human): 10874
Entry
10874             CDS       T01001                                 
Symbol
NMU
Name
(RefSeq) neuromedin U
  KO
K05249  neuromedin U
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10874 (NMU)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    10874 (NMU)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (GPCR binding)
   10874 (NMU)
SSDB
Motif
Pfam: NMU
Other DBs
NCBI-GeneID: 10874
NCBI-ProteinID: NP_006672
OMIM: 605103
HGNC: 7859
Ensembl: ENSG00000109255
CPD: C15869
UniProt: P48645 A0A250SH36
Position
4:complement(55595231..55636793)
AA seq 174 aa
MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDD
TCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVV
SSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
NT seq 525 nt   +upstreamnt  +downstreamnt
atgctgcgaacagagagctgccgccccaggtcgcccgccggacaggtggccgcggcgtcc
ccgctcctgctgctgctgctgctgctcgcctggtgcgcgggcgcctgccgaggtgctcca
atattacctcaaggattacagcctgaacaacagctacagttgtggaatgagatagatgat
acttgttcgtcttttctgtccattgattctcagcctcaggcatccaacgcactggaggag
ctttgctttatgattatgggaatgctaccaaagcctcaggaacaagatgaaaaagataat
actaaaaggttcttatttcattattcgaagacacagaagttgggcaagtcaaatgttgtg
tcgtcagttgtgcatccgttgctgcagctcgttcctcacctgcatgagagaagaatgaag
agattcagagtggacgaagaattccaaagtccctttgcaagtcaaagtcgaggatatttt
ttattcaggccacggaatggaagaaggtcagcagggttcatttaa

DBGET integrated database retrieval system