KEGG   Homo sapiens (human): 10875
Entry
10875             CDS       T01001                                 
Symbol
FGL2, T49, pT49
Name
(RefSeq) fibrinogen like 2
  KO
K25537  fibroleukin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10875 (FGL2)
SSDB
Motif
Pfam: Fibrinogen_C FlaC_arch SOGA DUF4618 Laminin_II CCDC-167 gag_pre-integrs
Other DBs
NCBI-GeneID: 10875
NCBI-ProteinID: NP_006673
OMIM: 605351
HGNC: 3696
Ensembl: ENSG00000127951
Pharos: Q14314(Tbio)
UniProt: Q14314 A4D1B8
Position
7:complement(77193369..77199819)
AA seq 439 aa
MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVS
LPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTG
APGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANL
TFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEV
YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
RIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPD
KDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
YKSSFKEAKMMIRPKHFKP
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaagctggctaactggtactggctgagctcagctgttcttgccacttacggttttttg
gttgtggcaaacaatgaaacagaggaaattaaagatgaaagagcaaaggatgtctgccca
gtgagactagaaagcagagggaaatgcgaagaggcaggggagtgcccctaccaggtaagc
ctgccccccttgactattcagctcccgaagcaattcagcaggatcgaggaggtgttcaaa
gaagtccaaaacctcaaggaaatcgtaaatagtctaaagaaatcttgccaagactgcaag
ctgcaggctgatgacaacggagacccaggcagaaacggactgttgttacccagtacagga
gccccgggagaggttggtgataacagagttagagaattagagagtgaggttaacaagctg
tcctctgagctaaagaatgccaaagaggagatcaatgtacttcatggtcgcctggagaag
ctgaatcttgtaaatatgaacaacatagaaaattatgttgacagcaaagtggcaaatcta
acatttgttgtcaatagtttggatggcaaatgttcaaagtgtcccagccaagaacaaata
cagtcacgtccagttcaacatctaatatataaagattgctctgactactacgcaataggc
aaaagaagcagtgagacctacagagttacacctgatcccaaaaatagtagctttgaagtt
tactgtgacatggagaccatggggggaggctggacagtgctgcaggcacgtctcgatggg
agcaccaacttcaccagaacatggcaagactacaaagcaggctttggaaacctcagaagg
gaattttggctggggaacgataaaattcatcttctgaccaagagtaaggaaatgattctg
agaatagatcttgaagactttaatggtgtcgaactatatgccttgtatgatcagttttat
gtggctaatgagtttctcaaatatcgtttacacgttggtaactataatggcacagctgga
gatgcattacgtttcaacaaacattacaaccacgatctgaagtttttcaccactccagat
aaagacaatgatcgatatccttctgggaactgtgggctgtactacagttcaggctggtgg
tttgatgcatgtctttctgcaaacttaaatggcaaatattatcaccaaaaatacagaggt
gtccgtaatgggattttctggggtacctggcctggtgtaagtgaggcacaccctggtggc
tacaagtcctccttcaaagaggctaagatgatgatcagacccaagcactttaagccataa

DBGET integrated database retrieval system