KEGG   Homo sapiens (human): 10878Help
Entry
10878             CDS       T01001                                 

Gene name
CFHR3, CFHL3, DOWN16, FHR-3, FHR3, HLF4
Definition
(RefSeq) complement factor H related 3
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10878 (CFHR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 10878
NCBI-ProteinID: NP_066303
OMIM: 605336
HGNC: 16980
Ensembl: ENSG00000116785
Vega: OTTHUMG00000035929
Pharos: Q02985(Tbio)
UniProt: Q02985
Position
1q31.3
AA seq 330 aa AA seqDB search
MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFE
TPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGL
PKAQTTVTCTEKGWSPTPRCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYA
TADGNSSGSITCLQNGWSAQPICINSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQ
PYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEF
MCKLGYNANTSILSFQAVCREGIVEYPRCE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttgttactaatcaatgtcattctgaccttgtgggtttcctgtgctaatggacaagtg
aaaccttgtgattttccagacattaaacatggaggtctatttcatgagaatatgcgtaga
ccatactttccagtagctgtaggaaaatattactcctattactgtgatgaacattttgag
actccttcaggaagttactgggattacattcattgcacacaaaatgggtggtcaccagca
gtaccatgtctcagaaaatgttattttccttatttggaaaatggatataatcaaaattat
ggaagaaagtttgtacagggtaactctacagaagttgcctgccatcctggctacggtctt
ccaaaagcgcagaccacagttacatgtacggagaaaggctggtctcctactcccagatgc
atccgtgtcagaacatgctcaaaatcagatatagaaattgaaaatggattcatttccgaa
tcttcctctatttatattttaaataaagaaatacaatataaatgtaaaccaggatatgca
acagcagatggaaattcttcaggatcaattacatgtttgcaaaatggatggtcagcacaa
ccaatttgcattaattcttcagaaaagtgtgggcctcctccacctattagcaatggtgat
accacctcctttctactaaaagtgtatgtgccacagtcaagagtcgagtaccaatgccag
ccctactatgaacttcagggttctaattatgtaacatgtagtaatggagagtggtcggaa
ccaccaagatgcatacatccatgtataataactgaagaaaacatgaataaaaataacata
aagttaaaaggaagaagtgacagaaaatattatgcaaaaacaggggataccattgaattt
atgtgtaaattgggatataatgcaaatacatcaattctatcatttcaagcagtgtgtcgg
gaagggatagtggaataccccagatgcgaataa

DBGET integrated database retrieval system