KEGG   Homo sapiens (human): 1088Help
Entry
1088              CDS       T01001                                 

Gene name
CEACAM8, CD66b, CD67, CGM6, NCA-95
Definition
(RefSeq) carcinoembryonic antigen related cell adhesion molecule 8
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Arcitumomab: D02977
Cergutuzumab: D11110
Cergutuzumab amunaleukin: D10917
Indium (111In) pentetic acid (DG01189): D04524
Labetuzumab: D08936
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 labetuzumab: D06350
Yttrium Y 90 labetuzumab tetraxetan: D06351
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1088 (CEACAM8)
   04090 CD molecules [BR:hsa04090]
    1088 (CEACAM8)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1088 (CEACAM8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1088 (CEACAM8)
  Exosomal proteins of bladder cancer cells
   1088 (CEACAM8)
CD molecules [BR:hsa04090]
 Proteins
  1088 (CEACAM8)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  1088 (CEACAM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 V-set I-set ig Ig_4 Ig_5
Motif
Other DBs
NCBI-GeneID: 1088
NCBI-ProteinID: NP_001807
OMIM: 615747
HGNC: 1820
Ensembl: ENSG00000124469
Vega: OTTHUMG00000151124
Pharos: P31997(Tbio)
UniProt: P31997 Q0Z7S6 B4DLI3
Structure
PDB: 

Position
19q13.2
AA seq 349 aa AA seqDB search
MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQ
DPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY
TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWV
NGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP
TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACH
TTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggggcccatctcagccccttcctgcagatggcgcatcccctggcaggggctcctgctc
acagcctcacttttcaccttctggaacccgcccaccactgctcagctcactattgaagct
gtgccatccaatgctgcagaggggaaggaggttcttctacttgtccacaatctgccccag
gaccctcgtggctacaactggtacaaaggggaaacagtggatgccaaccgtcgaattata
ggatatgtaatatcaaatcaacagattaccccagggcctgcatacagcaatcgagagaca
atataccccaatgcatccctgctgatgcggaacgtcaccagaaatgacacaggatcctac
accctacaagtcataaagctaaatcttatgagtgaagaagtaactggccagttcagcgta
catccggagactcccaagccctccatctccagcaacaactccaaccccgtggaggacaag
gatgctgtggccttcacctgtgaacctgagactcagaacacaacctacctgtggtgggta
aatggtcagagtctcccggtcagtcccaggctgcagctgtccaatggcaacaggaccctc
actctactcagtgtcacaaggaatgacgtaggaccctatgaatgtgaaatacagaaccca
gcgagtgcaaacttcagtgacccagtcaccctgaatgtcctctatggcccagatgccccc
accatttccccttcagacacctattaccatgcaggggtaaatctcaacctctcctgccat
gcggcctctaatccaccctcacagtattcttggtctgtcaatggcacattccagcaatac
acacaaaagctctttatccccaacatcactacaaagaacagcggatcctatgcctgccac
accactaactcagccactggccgcaacaggaccacagtcaggatgatcacagtctctgat
gctttagtacaaggaagttctcctggcctctcagctagagccactgtcagcatcatgatt
ggagtactggccagggtggctctgatatag

DBGET integrated database retrieval system