KEGG   Homo sapiens (human): 10880
Entry
10880             CDS       T01001                                 

Gene name
ACTL7B, Tact1
Definition
(RefSeq) actin like 7B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Actin MreB_Mbl
Other DBs
NCBI-GeneID: 10880
NCBI-ProteinID: NP_006677
OMIM: 604304
HGNC: 162
Ensembl: ENSG00000148156
Vega: OTTHUMG00000020462
Pharos: Q9Y614(Tbio)
UniProt: Q9Y614 A0A140VKC6
Position
9q31.3
AA seq 415 aa
MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQY
CKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIV
VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTS
QSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEA
GHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSE
MLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELS
LLCPGDSPAVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcgacaaggaacagccccatgcccctgggcacggctcagggtgaccctggagaggca
ggaacacggcccggccctgacgccagcctccgggacacaggtgcggccactcagctcaag
atgaagcccaggaaggtgcacaagatcaaggcggtcatcatcgacctgggctcccagtac
tgcaagtgcggctacgcgggagagccgaggcccacctacttcatctcctccaccgtgggc
aaacgctgccccgaggcggccgacgctggcgacacccgcaagtggactttagtgggccat
gagctgctcaacacggaggcgcctctcaagctggtgaacccgctgaagcacggcatcgtg
gtggactgggactgcgtgcaggacatctgggagtacatcttccgcaccgccatgaagatc
ctccccgaggagcacgctgtgctggtctccgaccctccgctcagccccagcagcaaccgg
gagaagtacgcggagctcatgtttgagaccttcggcatcccagccatgcacgtgacgtcc
cagtcgttgctgtccatctactcctacggcaagacctcggggctggtggtggagagcggg
cacggcgtctcgcacgtggtgcccatatccgagggcgacgtgctgccgggcctgaccagc
cgcgccgactacgctgggggtgacctcaccaactacctgatgcagctgctcaatgaggcg
ggccacgcattcacggacgaccacctgcacatcatagagcacatcaagaagaagtgctgc
tatgcggccttcctgcccgaggaggagctgggcctggtcccggaggagctgcgcgtggac
tacgagctcccggacggcaaactcatcactattggccaggagcgcttccgttgctctgag
atgctcttccagccctccctggcaggcagcacccagccgggcctcccggagctcacagct
gcctgcctgggccgctgccaggacacgggcttcaaggaggagatggccgccaacgtgcta
ctgtgtggcggctgcactatgctggatggcttccccgagcgcttccagagggagctgagc
ctcctctgccccggggacagccctgcagtggctgccgctcctgagaggaagacctccgtg
tggaccggcggttccatcctggcctccctgcaggccttccaacagctctgggtcagcaag
gaagagtttgaggagcggggcagcgtggccatctacagcaagtgctga

DBGET integrated database retrieval system