KEGG   Homo sapiens (human): 10881
Entry
10881             CDS       T01001                                 
Symbol
ACTL7A
Name
(RefSeq) actin like 7A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Actin ACTL7A_N MreB_Mbl N6_Mtase
Other DBs
NCBI-GeneID: 10881
NCBI-ProteinID: NP_006678
OMIM: 604303
HGNC: 161
Ensembl: ENSG00000187003
Pharos: Q9Y615(Tbio)
UniProt: Q9Y615 A0A140VK03
Structure
Position
9:108862266..108863756
AA seq 435 aa
MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAA
KERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQ
ELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNR
EKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITG
RLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCCFVALDPIEEKKVPLSEHTIR
YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL
CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVLPERDSAVWTGGSILASLQGFQPLWVHRF
EYEEHGPFFLYRRCF
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtgggctccaccagcagcaatcatgggggatgggcccaccaagaaggtgggcaaccag
gcccccctgcagacacaggccctccagactgcctctttaagggatggcccggcgaagcgg
gccgtgtgggtccgccatacgagttcagagccacaagaacctactgaatcaaaggcagcc
aaggagaggcccaagcaggaggtgaccaaagcagtggtcgtggacctgggcactggctac
tgtaaatgtggctttgccggcctgccaagacccacccacaagatctcaacaacggtgggc
aagccctacatggagaccgccaagactggggataatcgcaaggagacattcgtggggcag
gaactcaacaacacaaacgttcatctcaagctggttaaccctctgcgacatggcatcatc
gtggactgggatacagtgcaggatatctgggaatatctcttccgacaagagatgaagatc
gccccggaggagcatgcggtcttggtttcagacccgccactgagcccacacaccaacaga
gagaaatatgctgaaatgctgtttgaagccttcaacacccctgcaatgcacatcgcctac
cagtcgcgcctgtccatgtactcctatggaaggacctccggcctggtggtggaggtgggc
catggcgtgtcctacgtggtccccatctacgagggttatcctttgcccagcatcaccgga
aggctggactacgcgggctctgacctgacagcctacctgctgggcctgctgaacagtgcg
gggaacgaattcacccaggaccagatgggcatcgtggaggacatcaagaagaaatgctgc
tttgtggccctggatcccattgaggagaagaaagtccctctcagtgagcatacgatccgc
tacgtgctgccggatgggaaggagattcagctgtgccaggaacggttcctctgctcggag
atgttcttcaagccatctctcatcaagtccatgcagctgggcctccacacccaaaccgtg
tcctgccttaacaagtgtgacatcgccctcaaacgggacctcatggggaacatcctgctc
tgcgggggcagcacgatgctcagtggcttccctaaccgtctgcagaaggagctaagcagc
atgtgtcccaatgacaccccgcaggtaaacgtgctgcctgaaagagacagtgccgtgtgg
accggtggctccatcctggcctcacttcagggtttccaaccattgtgggtccaccgcttt
gagtacgaggaacacgggcctttcttcctctacagaaggtgcttctga

DBGET integrated database retrieval system