KEGG   Homo sapiens (human): 10882
Entry
10882             CDS       T01001                                 
Symbol
C1QL1, C1QRF, C1QTNF14, CRF, CTRP14
Name
(RefSeq) complement C1q like 1
  KO
K23284  C1q-related factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10882 (C1QL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    10882 (C1QL1)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 10882
NCBI-ProteinID: NP_006679
OMIM: 611586
HGNC: 24182
Ensembl: ENSG00000131094
Pharos: O75973(Tdark)
UniProt: O75973
Position
17:complement(44959693..44968303)
AA seq 258 aa
MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPP
PSTLVQGPQGKPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAIS
TATYTTVPRVAFYAGLKNPHEGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHV
LMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVILHLDAGDEVFIKLDGGKAH
GGNSNKYSTFSGFIIYSD
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctgctggtgctggtggtgctcatccccgtgctggtgagctcgggcggcccggaaggc
cactatgagatgctgggcacctgccgcatggtgtgcgacccctaccccgcgcggggcccc
ggcgccggcgcgcggaccgacggcggcgacgccctgagcgagcagagcggcgcgcccccg
ccttccacgctggtgcagggcccccaggggaagccgggccgcaccggcaagcccggccct
ccggggcctcccggggacccaggtcctcccggccctgtggggccgccgggggagaagggt
gagccaggcaagccgggccctccggggctgccgggcgcggggggcagcggcgccatcagc
actgccacctacaccacggtgccgcgcgtggccttctacgccggcctcaagaacccccac
gagggttacgaggtactcaagtttgacgacgtggtcaccaacctaggcaacaactacgac
gcggccagcggcaagtttacgtgcaacattcccggcacctactttttcacctaccatgtc
ctcatgcgcggcggcgacggcaccagtatgtgggcagacctctgcaagaatggccaggtg
cgggccagtgctattgcccaggacgcggaccagaactacgactacgccagcaacagcgtg
atcctgcacctggacgccggcgacgaggtcttcatcaagctggatggaggcaaagcacac
ggcggcaacagcaacaaatacagcacgttctctggcttcatcatctactccgactga

DBGET integrated database retrieval system