KEGG   Homo sapiens (human): 10884Help
Entry
10884             CDS       T01001                                 

Gene name
MRPS30, MRP-S30, PAP, PDCD9, S30mt
Definition
(RefSeq) mitochondrial ribosomal protein S30
  KO
K17409  small subunit ribosomal protein S30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    10884 (MRPS30)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    10884 (MRPS30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDCD9 Trypan_PARP Adeno_E1A
Motif
Other DBs
NCBI-GeneID: 10884
NCBI-ProteinID: NP_057724
OMIM: 611991
HGNC: 8769
Ensembl: ENSG00000112996
Vega: OTTHUMG00000096967
Pharos: Q9NP92(Tbio)
UniProt: Q9NP92
Structure
PDB: 

Position
5p12
AA seq 439 aa AA seqDB search
MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARL
RRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPP
PPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQL
VSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQ
IRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFH
LLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAV
ITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ
IVHFLLNRPKEEKSQLLEN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaggtgttggaggcctttgctacgcggtccgaggctttcattgcacacc
gcggctaatgccgccgccacggctacagaaacgacctgccaagacgtcgcggcgaccccc
gtcgcgcggtacccgccgattgtggcctccatgacagccgacagcaaagctgcacggctg
cggcggatcgagcgctggcaggcgacggtgcacgctgcggagtcggtagacgagaagctg
cgaatcctcaccaagatgcagtttatgaagtacatggtttacccgcagaccttcgcgctg
aatgccgaccgctggtaccagtacttcaccaagaccgtgttcctgtcgggtctgccgccg
cccccagcggagcccgagcccgagcccgaacccgaacctgaacctgcgctggacctcgcg
gcgctgcgtgcggtcgcctgcgactgcctgctgcaggagcacttctacctgcggcgcagg
cggcgcgtgcaccgttacgaggagagcgaggtcatatctttgcccttcctggatcagctg
gtgtcaaccctcgtgggcctcctcagcccacacaacccggccctggccgctgccgccctc
gattatagatgcccagttcatttttactgggtgcgtggtgaagaaattattcctcgtggt
catcgaagaggtcgaattgatgacttgcgataccagatagatgataaaccaaacaaccag
attcgaatatccaagcaactcgcagagtttgtgccattggattattctgttcctatagaa
atccccactataaaatgtaaaccagacaaacttccattattcaaacggcagtatgaaaac
cacatatttgttggctcaaaaactgcagatccttgctgttacggtcacacccagtttcat
ctgttacctgacaaattaagaagggaaaggcttttgagacaaaactgtgctgatcagata
gaagttgtttttagagctaatgctattgcaagcctttttgcttggactggagcacaagct
atgtatcaaggattctggagtgaagcagatgttactcgaccttttgtctcccaggctgtg
atcacagatggaaaatacttttcctttttctgctaccagctaaatactttggcactgact
acacaagctgatcaaaataaccctcgtaaaaatatatgttggggtacacaaagtaagcct
ctttatgaaacaattgaggataatgatgtgaaaggttttaatgatgatgttctacttcag
atagttcactttctactgaatagaccaaaagaagaaaaatcacagctgttggaaaactga

DBGET integrated database retrieval system