KEGG   Homo sapiens (human): 10886Help
Entry
10886             CDS       T01001                                 

Gene name
NPFFR2, GPR74, HLWAR77, NPFF2, NPGPR
Definition
(RefSeq) neuropeptide FF receptor 2
  KO
K08375  neuropeptide FF receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10886 (NPFFR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10886 (NPFFR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide FF
    10886 (NPFFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 10886
NCBI-ProteinID: NP_004876
OMIM: 607449
HGNC: 4525
Ensembl: ENSG00000056291
Vega: OTTHUMG00000129918
Pharos: Q9Y5X5(Tchem)
UniProt: Q9Y5X5
Position
4q13.3
AA seq 522 aa AA seqDB search
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR
LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN
VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT
VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA
IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN
QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ
LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcttcttcggaaccccagcggccagctggtgcctcctggaaagtgacgtctca
tctgcaccggacaaggaggcggggagggagcgcagagcactcagcgtccagcagcgcggc
gggccagcctggagcggaagcctggagtggagcaggcagtccgcgggggacagacgtcgg
ctgggattgagccggcagactgcgaaaagtagctggagccggagcagggacagaacctgt
tgctgcagacgggcttggtggattctggttcctgccgccgacagggctcgccgggagagg
ttcatcatgaatgagaaatgggacacaaactcttcagaaaactggcatcccatctggaat
gtcaatgacacaaagcatcatctgtactcagatattaatattacctatgtgaactactat
cttcaccagcctcaagtggcagcaatcttcattatttcctactttctgatcttctttttg
tgcatgatgggaaatactgtggtttgctttattgtaatgaggaacaaacatatgcacaca
gtcactaatctcttcatcttaaacctggccataagtgatttactagttggcatattctgc
atgcctataacactgctggacaatattatagcaggatggccatttggaaacacgatgtgc
aagatcagtggattggtccagggaatatctgtcgcagcttcagtctttacgttagttgca
attgctgtagataggttccagtgtgtggtctacccttttaaaccaaagctcactatcaag
acagcgtttgtcattattatgatcatctgggtcctagccatcaccattatgtctccatct
gcagtaatgttacatgtgcaagaagaaaaatattaccgagtgagactcaactcccagaat
aaaaccagtccagtctactggtgccgggaagactggccaaatcaggaaatgaggaagatc
tacaccactgtgctgtttgccaacatctacctggctcccctctccctcattgtcatcatg
tatggaaggattggaatttcactcttcagggctgcagttcctcacacaggcaggaagaac
caggagcagtggcacgtggtgtccaggaagaagcagaagatcattaagatgctcctgatt
gtggccctgctttttattctctcatggctgcccctgtggactctaatgatgctctcagac
tacgctgacctttctccaaatgaactgcagatcatcaacatctacatctacccttttgca
cactggctggcattcggcaacagcagtgtcaatcccatcatttatggtttcttcaacgag
aatttccgccgtggtttccaagaagctttccagctccagctctgccaaaaaagagcaaag
cctatggaagcttatgccctaaaagctaaaagccatgtgctcataaacacatctaatcag
cttgtccaggaatctacatttcaaaaccctcatggggaaaccttgctttataggaaaagt
gctgaaaaaccccaacaggaattagtgatggaagaattaaaagaaactactaacagcagt
gagatttaa

DBGET integrated database retrieval system