KEGG   Homo sapiens (human): 10886
Entry
10886             CDS       T01001                                 

Gene name
NPFFR2, GPR74, HLWAR77, NPFF2, NPGPR
Definition
(RefSeq) neuropeptide FF receptor 2
  KO
K08375  neuropeptide FF receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10886 (NPFFR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10886 (NPFFR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide FF
    10886 (NPFFR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 10886
NCBI-ProteinID: NP_001138228
OMIM: 607449
HGNC: 4525
Ensembl: ENSG00000056291
Vega: OTTHUMG00000129918
Pharos: Q9Y5X5(Tchem)
UniProt: Q9Y5X5 A0PJM9
Position
4q13.3
AA seq 423 aa
MFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFF
LCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTM
CKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSP
SAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVI
MYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLS
DYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRA
KPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNS
SEI
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgttcatcatgaatgagaaatgggacacaaactcttcagaaaactggcatcccatctgg
aatgtcaatgacacaaagcatcatctgtactcagatattaatattacctatgtgaactac
tatcttcaccagcctcaagtggcagcaatcttcattatttcctactttctgatcttcttt
ttgtgcatgatgggaaatactgtggtttgctttattgtaatgaggaacaaacatatgcac
acagtcactaatctcttcatcttaaacctggccataagtgatttactagttggcatattc
tgcatgcctataacactgctggacaatattatagcaggatggccatttggaaacacgatg
tgcaagatcagtggattggtccagggaatatctgtcgcagcttcagtctttacgttagtt
gcaattgctgtagataggttccagtgtgtggtctacccttttaaaccaaagctcactatc
aagacagcgtttgtcattattatgatcatctgggtcctagccatcaccattatgtctcca
tctgcagtaatgttacatgtgcaagaagaaaaatattaccgagtgagactcaactcccag
aataaaaccagtccagtctactggtgccgggaagactggccaaatcaggaaatgaggaag
atctacaccactgtgctgtttgccaacatctacctggctcccctctccctcattgtcatc
atgtatggaaggattggaatttcactcttcagggctgcagttcctcacacaggcaggaag
aaccaggagcagtggcacgtggtgtccaggaagaagcagaagatcattaagatgctcctg
attgtggccctgctttttattctctcatggctgcccctgtggactctaatgatgctctca
gactacgctgacctttctccaaatgaactgcagatcatcaacatctacatctaccctttt
gcacactggctggcattcggcaacagcagtgtcaatcccatcatttatggtttcttcaac
gagaatttccgccgtggtttccaagaagctttccagctccagctctgccaaaaaagagca
aagcctatggaagcttatgccctaaaagctaaaagccatgtgctcataaacacatctaat
cagcttgtccaggaatctacatttcaaaaccctcatggggaaaccttgctttataggaaa
agtgctgaaaaaccccaacaggaattagtgatggaagaattaaaagaaactactaacagc
agtgagatttaa

KEGG   Homo sapiens (human): 64106
Entry
64106             CDS       T01001                                 

Gene name
NPFFR1, GPR147, NPFF1, NPFF1R1, OT7T022
Definition
(RefSeq) neuropeptide FF receptor 1
  KO
K04240  neuropeptide FF receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    64106 (NPFFR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    64106 (NPFFR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide FF
    64106 (NPFFR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF420
Other DBs
NCBI-GeneID: 64106
NCBI-ProteinID: NP_071429
OMIM: 607448
HGNC: 17425
Ensembl: ENSG00000148734
Vega: OTTHUMG00000018404
Pharos: Q9GZQ6(Tchem)
UniProt: Q9GZQ6
Position
10q22.1
AA seq 430 aa
MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG
NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG
LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL
TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA
RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA
PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY
SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH
LPLTIPAWDI
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggagggggagccctcccagcctcccaacagcagttggcccctaagtcagaatgggact
aacactgaggccaccccggctacaaacctcaccttctcctcctactatcagcacacctcc
cctgtggcggccatgttcattgtggcctatgcgctcatcttcctgctctgcatggtgggc
aacaccctggtctgtttcatcgtgctcaagaaccggcacatgcatactgtcaccaacatg
ttcatcctcaacctggctgtcagtgacctgctggtgggcatcttctgcatgcccaccacc
cttgtggacaacctcatcactgggtggcccttcgacaatgccacatgcaagatgagcggc
ttggtgcagggcatgtctgtgtcggcttccgttttcacactggtggccattgctgtggaa
aggttccgctgcatcgtgcaccctttccgcgagaagctgaccctgcggaaggcgctcgtc
accatcgccgtcatctgggccctggcgctgctcatcatgtgtccctcggccgtcacgctg
accgtcacccgtgaggagcaccacttcatggtggacgcccgcaaccgctcctacccgctc
tactcctgctgggaggcctggcccgagaagggcatgcgcagggtctacaccactgtgctc
ttctcgcacatctacctggcgccgctggcgctcatcgtggtcatgtacgcccgcatcgcg
cgcaagctctgccaggccccgggcccggcccccgggggcgaggaggctgcggacccgcga
gcatcgcggcgcagagcgcgcgtggtgcacatgctggtcatggtggcgctgttcttcacg
ctgtcctggctgccgctctgggcgctgctgctgctcatcgactacgggcagctcagcgcg
ccgcagctgcacctggtcaccgtctacgccttccccttcgcgcactggctggccttcttc
aacagcagcgccaaccccatcatctacggctacttcaacgagaacttccgccgcggcttc
caggccgccttccgcgcccgcctctgcccgcgcccgtcggggagccacaaggaggcctac
tccgagcggcccggcgggcttctgcacaggcgggtcttcgtggtggtgcggcccagcgac
tccgggctgccctctgagtcgggccctagcagtggggcccccaggcccggccgcctcccg
ctgcggaatgggcgggtggctcaccacggcttgcccagggaagggcctggctgctcccac
ctgcccctcaccattccagcctgggatatctga

DBGET integrated database retrieval system