KEGG   Homo sapiens (human): 10888
Entry
10888             CDS       T01001                                 

Gene name
GPR83, GIR, GPR72
Definition
(RefSeq) G protein-coupled receptor 83
  KO
K04210  G protein-coupled receptor 83
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10888 (GPR83)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10888 (GPR83)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10888 (GPR83)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Neuropeptide Y
    10888 (GPR83)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 10888
NCBI-ProteinID: NP_057624
OMIM: 605569
HGNC: 4523
Ensembl: ENSG00000123901
Vega: OTTHUMG00000167779
Pharos: Q9NYM4(Tbio)
UniProt: Q9NYM4
Position
11q21
AA seq 423 aa
MVPHLLLLCLLPLVRATEPHEGRADEQSAEAALAVPNASHFFSWNNYTFSDWQNFVGRRR
YGAESQNPTVKALLIVAYSFIIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMI
TLLNTPFTLVRFVNSTWIFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPR
ISITKGVIYIAVIWTMATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLD
LATFILLYILPLLIISVAYARVAKKLWLCNMIGDVTTEQYFALRRKKKKTIKMLMLVVVL
FALCWFPLNCYVLLLSSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALL
SMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIV
TMS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggtccctcacctcttgctgctctgtctcctccccttggtgcgagccaccgagccccac
gagggccgggccgacgagcagagcgcggaggcggccctggccgtgcccaatgcctcgcac
ttcttctcttggaacaactacaccttctccgactggcagaactttgtgggcaggaggcgc
tacggcgctgagtcccagaaccccacggtgaaagccctgctcattgtggcttactccttc
atcattgtcttctcactctttggcaacgtcctggtctgtcatgtcatcttcaagaaccag
cgaatgcactcggccaccagcctcttcatcgtcaacctggcagttgccgacataatgatc
acgctgctcaacacccccttcactttggttcgctttgtgaacagcacatggatatttggg
aagggcatgtgccatgtcagccgctttgcccagtactgctcactgcacgtctcagcactg
acactgacagccattgcggtggatcgccaccaggtcatcatgcaccccttgaaaccccgg
atctcaatcacaaagggtgtcatctacatcgctgtcatctggaccatggctacgttcttt
tcactcccacatgctatctgccagaaattatttaccttcaaatacagtgaggacattgtg
cgctccctctgcctgccagacttccctgagccagctgacctcttctggaagtacctggac
ttggccaccttcatcctgctctacatcctgcccctcctcatcatctctgtggcctacgct
cgtgtggccaagaaactgtggctgtgtaatatgattggcgatgtgaccacagagcagtac
tttgccctgcggcgcaaaaagaagaagaccatcaagatgttgatgctggtggtagtcctc
tttgccctctgctggttccccctcaactgctacgtcctcctcctgtccagcaaggtcatc
cgcaccaacaatgccctctactttgccttccactggtttgccatgagcagcacctgctat
aaccccttcatatactgctggctgaacgagaacttcaggattgagctaaaggcattactg
agcatgtgtcaaagacctcccaagcctcaggaggacaggccaccctccccagttccttcc
ttcagggtggcctggacagagaagaatgatggccagagggctccccttgccaataacctc
ctgcccacctcccaactccagtctgggaagacagacctgtcatctgtggaacccattgtg
acgatgagttag

DBGET integrated database retrieval system