KEGG   Homo sapiens (human): 10891Help
Entry
10891             CDS       T01001                                 

Gene name
PPARGC1A, LEM6, PGC-1(alpha), PGC-1alpha, PGC-1v, PGC1, PGC1A, PPARGC1
Definition
(RefSeq) PPARG coactivator 1 alpha
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04371  Apelin signaling pathway
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10891 (PPARGC1A)
   04152 AMPK signaling pathway
    10891 (PPARGC1A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    10891 (PPARGC1A)
   04922 Glucagon signaling pathway
    10891 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    10891 (PPARGC1A)
  09149 Aging
   04211 Longevity regulating pathway
    10891 (PPARGC1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    10891 (PPARGC1A)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    10891 (PPARGC1A)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    10891 (PPARGC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10891 (PPARGC1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    10891 (PPARGC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Tox-ODYAM1
Motif
Other DBs
NCBI-GeneID: 10891
NCBI-ProteinID: NP_037393
OMIM: 604517
HGNC: 9237
Ensembl: ENSG00000109819
Vega: OTTHUMG00000097747
Pharos: Q9UBK2(Tbio)
UniProt: Q9UBK2 A0A024R9Q9
Position
4p15.2
AA seq 798 aa AA seqDB search
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggacatgtgcaaccaggactctgagtctgtatggagtgacatcgagtgtgct
gctctggttggtgaagaccagcctctttgcccagatcttcctgaacttgatctttctgaa
ctagatgtgaacgacttggatacagacagctttctgggtggactcaagtggtgcagtgac
caatcagaaataatatccaatcagtacaacaatgagccttcaaacatatttgagaagata
gatgaagagaatgaggcaaacttgctagcagtcctcacagagacactagacagtctccct
gtggatgaagacggattgccctcatttgatgcgctgacagatggagacgtgaccactgac
aatgaggctagtccttcctccatgcctgacggcacccctccaccccaggaggcagaagag
ccgtctctacttaagaagctcttactggcaccagccaacactcagctaagttataatgaa
tgcagtggtctcagtacccagaaccatgcaaatcacaatcacaggatcagaacaaaccct
gcaattgttaagactgagaattcatggagcaataaagcgaagagtatttgtcaacagcaa
aagccacaaagacgtccctgctcggagcttctcaaatatctgaccacaaacgatgaccct
cctcacaccaaacccacagagaacagaaacagcagcagagacaaatgcacctccaaaaag
aagtcccacacacagtcgcagtcacaacacttacaagccaaaccaacaactttatctctt
cctctgaccccagagtcaccaaatgaccccaagggttccccatttgagaacaagactatt
gaacgcaccttaagtgtggaactctctggaactgcaggcctaactccacccaccactcct
cctcataaagccaaccaagataacccttttagggcttctccaaagctgaagtcctcttgc
aagactgtggtgccaccaccatcaaagaagcccaggtacagtgagtcttctggtacacaa
ggcaataactccaccaagaaagggccggagcaatccgagttgtatgcacaactcagcaag
tcctcagtcctcactggtggacacgaggaaaggaagaccaagcggcccagtctgcggctg
tttggtgaccatgactattgccagtcaattaattccaaaacagaaatactcattaatata
tcacaggagctccaagactctagacaactagaaaataaagatgtctcctctgattggcag
gggcagatttgttcttccacagattcagaccagtgctacctgagagagactttggaggca
agcaagcaggtctctccttgcagcacaagaaaacagctccaagaccaggaaatccgagcc
gagctgaacaagcacttcggtcatcccagtcaagctgtttttgacgacgaagcagacaag
accggtgaactgagggacagtgatttcagtaatgaacaattctccaaactacctatgttt
ataaattcaggactagccatggatggcctgtttgatgacagcgaagatgaaagtgataaa
ctgagctacccttgggatggcacgcaatcctattcattgttcaatgtgtctccttcttgt
tcttcttttaactctccatgtagagattctgtgtcaccacccaaatccttattttctcaa
agaccccaaaggatgcgctctcgttcaaggtccttttctcgacacaggtcgtgttcccga
tcaccatattccaggtcaagatcaaggtctccaggcagtagatcctcttcaagatcctgc
tattactatgagtcaagccactacagacaccgcacgcaccgaaattctcccttgtatgtg
agatcacgttcaagatcgccctacagccgtcggcccaggtatgacagctacgaggaatat
cagcacgagaggctgaagagggaagaatatcgcagagagtatgagaagcgagagtctgag
agggccaagcaaagggagaggcagaggcagaaggcaattgaagagcgccgtgtgatttat
gtcggtaaaatcagacctgacacaacacggacagaactgagggaccgttttgaagttttt
ggtgaaattgaggagtgcacagtaaatctgcgggatgatggagacagctatggtttcatt
acctaccgttatacctgtgatgcttttgctgctcttgaaaatggatacactttgcgcagg
tcaaacgaaactgactttgagctgtacttttgtggacgcaagcaatttttcaagtctaac
tatgcagacctagattcaaactcagatgactttgaccctgcttccaccaagagcaagtat
gactctctggattttgatagtttactgaaagaagctcagagaagcttgcgcaggtaa

DBGET integrated database retrieval system