KEGG   Homo sapiens (human): 10892Help
Entry
10892             CDS       T01001                                 

Gene name
MALT1, IMD12, MLT, MLT1, PCASP1
Definition
(RefSeq) MALT1 paracaspase
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    10892 (MALT1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    10892 (MALT1)
   04660 T cell receptor signaling pathway
    10892 (MALT1)
   04662 B cell receptor signaling pathway
    10892 (MALT1)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    10892 (MALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    10892 (MALT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     10892 (MALT1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   10892 (MALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 Peptidase_C14 ig I-set Ig_5 V-set Ig_4
Motif
Other DBs
NCBI-GeneID: 10892
NCBI-ProteinID: NP_006776
OMIM: 604860
HGNC: 6819
Ensembl: ENSG00000172175
Vega: OTTHUMG00000132761
Pharos: Q9UDY8(Tbio)
UniProt: Q9UDY8 A8K5S1
Structure
PDB: 

Position
18q21.32
AA seq 824 aa AA seqDB search
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgttgggggacccgctacaggccctgccgccctcggccgcccccacggggccg
ctgctcgcccctccggccggcgcgaccctcaaccgcctgcgggagccgctgctgcggagg
ctcagcgagctcctggatcaggcgcccgagggccggggctggaggagactggcggagctg
gcggggagtcgcgggcgcctccgcctcagttgcctagacctggagcagtgttctcttaag
gtactggagcctgaaggaagccccagcctgtgtctgctgaagttaatgggtgaaaaaggt
tgcacagtcacagaattgagtgatttcctgcaggctatggaacacactgaagttcttcag
cttctcagccccccaggaataaagattactgtaaacccagagtcaaaggcagtcttggct
ggacagtttgtgaaactgtgttgccgggcaactggacatccttttgttcaatatcagtgg
ttcaaaatgaataaagagattccaaatggaaatacatcagagcttatttttaatgcagtg
catgtaaaagatgcaggcttttatgtctgtcgagttaataacaatttcacctttgaattc
agccagtggtcacagctggatgtttgcgacatcccagagagcttccagagaagtgttgat
ggcgtctctgaatccaagttgcaaatctgtgttgaaccaacttcccaaaagctgatgcca
ggcagcacattggttttacagtgtgttgctgttggaagccctattcctcactaccagtgg
ttcaaaaatgaattaccattaacacatgagaccaaaaagctatacatggtgccttatgtg
gatttggaacaccaaggaacctactggtgtcatgtatataatgatcgagacagtcaagat
agcaagaaggtagaaatcatcataggaagaacagatgaggcagtggagtgcactgaagat
gaattaaataatcttggtcatcctgataataaagagcaaacaactgaccagcctttggcg
aaggacaaggttgcccttttgataggaaatatgaattaccgggagcaccccaagctcaaa
gctcctttggtggatgtgtacgaattgactaacttactgagacagctggacttcaaagtg
gtttcactgttggatcttactgaatatgagatgcgtaatgctgtggatgagtttttactc
cttttagacaagggagtatatgggttattatattatgcaggacatggttatgaaaatttt
gggaacagcttcatggtccccgttgatgctccaaatccatataggtctgaaaattgtctg
tgtgtacaaaatatactgaaattgatgcaagaaaaagaaactggacttaatgtgttctta
ttggatatgtgtaggaaaagaaatgactacgatgataccattccaatcttggatgcacta
aaagtcaccgccaatattgtgtttggatatgccacgtgtcaaggagcagaagcttttgaa
atccagcattctggattggcaaatggaatctttatgaaatttttaaaagacagattatta
gaagataagaaaatcactgtgttactggatgaagttgcagaagatatgggtaagtgtcac
cttaccaaaggcaaacaggctctagagattcgaagtagtttatctgagaagagagcactt
actgatccaatacagggaacagaatattctgctgaatctcttgtgcggaatctacagtgg
gccaaggctcatgaacttccagaaagtatgtgtcttaagtttgactgtggtgttcagatt
caattaggatttgcagctgagttttccaatgtcatgatcatctatacaagtatagtttac
aaaccaccggagataataatgtgtgatgcctacgttactgattttccacttgatctagat
attgatccaaaagatgcaaataaaggcacacctgaagaaactggcagctacttggtatca
aaggatcttcccaagcattgcctctataccagactcagttcactgcaaaaattaaaggaa
catctagtcttcacagtatgtttatcatatcagtactcaggattggaagatactgtagag
gacaagcaggaagtgaatgttgggaaacctctcattgctaaattagacatgcatcgaggt
ttgggaaggaagacttgctttcaaacttgtcttatgtctaatggtccttaccagagttct
gcagccacctcaggaggagcagggcattatcactcattgcaagacccattccatggtgtt
taccattcacatcctggtaatccaagtaatgttacaccagcagatagctgtcattgcagc
cggactccagatgcatttatttcaagtttcgctcaccatgcttcatgtcattttagtaga
agtaatgtgccagtagagacaactgatgaaataccatttagtttctctgacaggctcaga
atttctgaaaaatga

DBGET integrated database retrieval system