KEGG   Homo sapiens (human): 10893Help
Entry
10893             CDS       T01001                                 

Gene name
MMP24, MMP-24, MMP25, MT-MMP_5, MT-MMP5, MT5-MMP, MT5MMP, MTMMP5
Definition
(RefSeq) matrix metallopeptidase 24
  KO
K08002  matrix metalloproteinase-24 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10893 (MMP24)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10893 (MMP24)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     10893 (MMP24)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   10893 (MMP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M66 Metallopep Reprolysin_3 DUF4953 Reprolysin_4 Reprolysin_5 RskA
Motif
Other DBs
NCBI-GeneID: 10893
NCBI-ProteinID: NP_006681
OMIM: 604871
HGNC: 7172
Ensembl: ENSG00000125966
Vega: OTTHUMG00000032330
Pharos: Q9Y5R2(Tbio)
UniProt: Q9Y5R2 Q86VV6
Position
20q11.22
AA seq 645 aa AA seqDB search
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggagccggggcggccgcgccgcgccggggccgccgccgccgccgccgccgccg
ggccaggccccgcgctggagccgctggcgggtccctgggcggctgctgctgctgctgctg
cccgcgctctgctgcctcccgggcgccgcgcgggcggcggcggcggcggcgggggcaggg
aaccgggcagcggtggcggtggcggtggcgcgggcggacgaggcggaggcgcccttcgcc
gggcagaactggttaaagtcctatggctatctgcttccctatgactcacgggcatctgcg
ctgcactcagcgaaggccttgcagtcggcagtctccactatgcagcagttttacgggatc
ccggtcaccggtgtgttggatcagacaacgatcgagtggatgaagaaaccccgatgtggt
gtccctgatcacccccacttaagccgtaggcggagaaacaagcgctatgccctgactgga
cagaagtggaggcaaaaacacatcacctacagcattcacaactataccccaaaagtgggt
gagctagacacgcggaaagctattcgccaggctttcgatgtgtggcagaaggtgacccca
ctgacctttgaagaggtgccataccatgagatcaaaagtgaccggaaggaggcagacatc
atgatcttttttgcttctggtttccatggcgacagctccccatttgatggagaaggggga
ttcctggcccatgcctacttccctggcccagggattggaggagacacccactttgactcc
gatgagccatggacgctaggaaatgccaaccatgacgggaacgacctcttcctggtggct
gtgcatgagctgggccacgcgctgggactggagcactccagcgaccccagcgccatcatg
gcgcccttctaccagtacatggagacgcacaacttcaagctgccccaggacgatctccag
ggcatccagaagatctatggacccccagccgagcctctggagcccacaaggccactccct
acactccccgtccgcaggatccactcaccatcggagaggaaacacgagcgccagcccagg
ccccctcggccgcccctcggggaccggccatccacaccaggcaccaaacccaacatctgt
gacggcaacttcaacacagtggccctcttccggggcgagatgtttgtctttaaggatcgc
tggttctggcgtctgcgcaataaccgagtgcaggagggctaccccatgcagatcgagcag
ttctggaagggcctgcctgcccgcatcgacgcagcctatgaaagggccgatgggagattt
gtcttcttcaaaggtgacaagtattgggtgtttaaggaggtgacggtggagcctgggtac
ccccacagcctgggggagctgggcagctgtttgccccgtgaaggcattgacacagctctg
cgctgggaacctgtgggcaagacctactttttcaaaggcgagcggtactggcgctacagc
gaggagcggcgggccacggaccctggctaccctaagcccatcaccgtgtggaagggcatc
ccacaggctccccaaggagccttcatcagcaaggaaggatattacacctatttctacaag
ggccgggactactggaagtttgacaaccagaaactgagcgtggagccaggctacccgcgc
aacatcctgcgtgactggatgggctgcaaccagaaggaggtggagcggcggaaggagcgg
cggctgccccaggacgacgtggacatcatggtgaccatcaacgatgtgccgggctccgtg
aacgccgtggccgtggtcatcccctgcatcctgtccctctgcatcctggtgctggtctac
accatcttccagttcaagaacaagacaggccctcagcctgtcacctactataagcggcca
gtccaggaatgggtgtga

DBGET integrated database retrieval system