KEGG   Homo sapiens (human): 10897Help
Entry
10897             CDS       T01001                                 

Gene name
YIF1A, 54TM, FinGER7, YIF1, YIF1P
Definition
(RefSeq) Yip1 interacting factor homolog A, membrane trafficking protein
  KO
K20362  protein transport protein YIF1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10897 (YIF1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    10897 (YIF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: YIF1 Yip1
Motif
Other DBs
NCBI-GeneID: 10897
NCBI-ProteinID: NP_065203
OMIM: 611484
HGNC: 16688
Ensembl: ENSG00000174851
Vega: OTTHUMG00000102079
Pharos: O95070(Tdark)
UniProt: O95070 A8K509
Position
11q13.2
AA seq 293 aa AA seqDB search
MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMA
NVAMAYGSSIASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEV
QYSRDAPLPPRQDLNAPDLYIPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVV
MEVLALLLGLYLATVRSDLSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSA
LMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcactcgggctacggagcccacggctccaagcacagggcccgggcagccccg
gatccccctcccctcttcgatgacacaagcggtggttattccagccagcccgggggatac
ccagccacaggagcagacgtggccttcagtgtcaaccacttgcttggggacccaatggcc
aatgtggctatggcctatggcagctccatcgcatcccatgggaaggacatggtgcacaag
gagctgcaccgttttgtgtctgtgagcaaactcaagtatttttttgctgtggacacagcc
tacgtggccaagaagctagggctgctggtcttcccctacacacaccagaactgggaagtg
cagtacagtcgtgatgctcctctgcccccccggcaagacctcaacgcccctgacctctat
atccccacgatggccttcattacttacgtgctcctggctgggatggcactgggcattcag
aaaaggttctccccggaggtgctgggcctgtgtgcaagcacagcgctggtgtgggtggtg
atggaggtgctggccctgctcctgggcctctacctggccaccgtgcgcagtgacctgagc
acctttcacctgctggcctacagtggctacaaatacgtgggaatgatcctcagtgtgctc
acggggctgctgttcggcagcgatggctactacgtggcgctggcctggacctcatcggcg
ctcatgtacttcattgtgcgctctttgcggacagcagccctgggccccgacagcatgggg
ggccccgtcccccggcagcgtctccagctctacctgactctgggagctgcagccttccag
cccctcatcatatactggctgactttccacctggtccggtga

DBGET integrated database retrieval system