KEGG   Homo sapiens (human): 10905
Entry
10905             CDS       T01001                                 

Symbol
MAN1A2, MAN1B
Name
(RefSeq) mannosidase alpha class 1A member 2
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    10905 (MAN1A2)
   00513 Various types of N-glycan biosynthesis
    10905 (MAN1A2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10905 (MAN1A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10905 (MAN1A2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     10905 (MAN1A2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    10905 (MAN1A2)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 10905
NCBI-ProteinID: NP_006690
OMIM: 604345
HGNC: 6822
Ensembl: ENSG00000198162
Vega: OTTHUMG00000012149
Pharos: O60476(Tdark)
UniProt: O60476
Position
1p12
AA seq 641 aa
MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
REKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGSSQMGATIVDALDTLYIMGLH
DEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKIKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLTGDLTYYKKVM
HIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
KMYDDAIEAIEKHLIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKA
GHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWY
LWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYL
YLLFSGDDLLPLDHWVFNTEAHPLPVLHLANTTLSGNPAVR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgactaccccagccctgctgcccctctctggacgtaggataccacctctgaacctgggg
ccgccttccttcccacatcacagggctaccttgagactttctgagaagtttattcttctc
cttattcttagtgccttcatcactctgtgttttggggcattctttttccttccagactct
tcaaaacacaaacgctttgatttgggtttagaagatgtgttaattccacatgtagatgcc
ggtaaaggggctaaaaaccccggagtcttcctgatccatggacccgatgaacatagacac
agggaagaggaagaacgtctgagaaataaaattcgagctgatcatgagaaggccttggaa
gaagcaaaagaaaaattaagaaagtcaagagaggaaattcgagcagaaattcagacagag
aaaaataaggtagtccaagaaatgaagataaaagagaacaagccactgccaccagtccct
attcccaaccttgtaggaatacgtggtggagacccagaagataatgacataagagagaaa
agggaaaaaattaaagagatgatgaaacatgcttgggataactataggacatatgggtgg
ggacataatgaactcagacctattgcaaggaaaggacactcccctaacatatttggaagt
tcacaaatgggtgctaccatagtagatgctttggataccctttatatcatgggacttcat
gatgaattcctagatgggcaaagatggattgaagacaaccttgatttcagtgtgaattca
gaggtgtctgtgtttgaagtcaacattcgatttattggaggcctacttgcagcatattac
ctatcaggagaggagatattcaagattaaagcagtgcaattggctgagaaactccttcct
gcctttaacacacctactgggattccttgggcaatggtgaatttgaaaagtggagtaggg
cgaaactggggctgggcatctgcaggtagcagcattctggctgaatttggtacactacat
atggagttcatccacctcagctacttgacaggggacctgacttactacaaaaaggttatg
cacattcggaaactacttcagaaaatggatcgtccaaatggtctttatccaaattatttg
aaccccagaacagggcgctggggtcagtatcatacatctgtcggtggcctgggagacagt
ttttatgaatacttactgaaagcatggttgatgtcagataaaacagaccatgaggcaaga
aagatgtatgatgatgctattgaggctatagaaaaacatcttattaagaagtctcgtgga
ggtcttacctttattggagaatggaagaatgggcacttggaaaaaaagatggggcatttg
gcctgctttgctgggggaatgtttgcactaggagcagatggttccagagcagataaagct
ggtcattatttagagctaggggcagaaattgcacgtacttgtcatgagtcatatgacaga
actgcattaaagctaggtcctgaatcattcaagtttgatggtgcagtggaggctgtggct
gtccggcaggctgaaaagtattatatcctccgtccagaagtaattgaaacctattggtac
ctatggcgattcactcacgatccaagatacaggcagtggggctgggaagcagcactggcc
attgaaaagtattgccgagttaatggtgggttttctggagtcaaagatgtatattcctct
actcctacacatgatgatgtacagcagagcttttttcttgctgaaacattaaaatatttg
tatctgctgttctccggtgatgaccttttacctttagaccactgggtgtttaatacagag
gctcaccctctgcctgtgttacatttagccaacaccacactttcaggtaatcctgctgtt
cgatga

KEGG   Homo sapiens (human): 11253
Entry
11253             CDS       T01001                                 

Symbol
MAN1B1, ERMAN1, ERManI, MANA-ER, MRT15
Name
(RefSeq) mannosidase alpha class 1B member 1
  KO
K23741  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase [EC:3.2.1.209]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    11253 (MAN1B1)
   00513 Various types of N-glycan biosynthesis
    11253 (MAN1B1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    11253 (MAN1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11253 (MAN1B1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.209  endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase
     11253 (MAN1B1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    11253 (MAN1B1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 11253
NCBI-ProteinID: NP_057303
OMIM: 604346
HGNC: 6823
Ensembl: ENSG00000177239
Vega: OTTHUMG00000020978
Pharos: Q9UKM7(Tchem)
UniProt: Q9UKM7
Structure
PDB: 

Position
9q34.3
AA seq 699 aa
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENY
DNSKSWRRRSCWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQK
MRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDG
TQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLPPARTQ
GTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI
LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGN
RLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQE
TQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHG
LPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPET
VESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFF
LGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggctgcctgcgagggcaggagaagcggagctctcggttcctctcagtcggacttcctg
acgccgccagtgggcggggccccttgggccgtcgccaccactgtagtcatgtacccaccg
ccgccgccgccgcctcatcgggacttcatctcggtgacgctgagctttggcgagaactat
gacaacagcaagagttggcggcggcgctcgtgctggaggaaatggaagcaactgtcgaga
ttgcagcggaatatgattctcttcctccttgcctttctgcttttctgtggactcctcttc
tacatcaacttggctgaccattggaaagctctggctttcaggctagaggaagagcagaag
atgaggccagaaattgctgggttaaaaccagcaaatccacccgtcttaccagctcctcag
aaggcggacaccgaccctgagaacttacctgagatttcgtcacagaagacacaaagacac
atccagcggggaccacctcacctgcagattagacccccaagccaagacctgaaggatggg
acccaggaggaggccacaaaaaggcaagaagcccctgtggatccccgcccggaaggagat
ccgcagaggacagtcatcagctggaggggagcggtgatcgagcctgagcagggcaccgag
ctcccttcaagaagagcagaagtgcccaccaagcctcccctgccaccggccaggacacag
ggcacaccagtgcatctgaactatcgccagaagggcgtgattgacgtcttcctgcatgca
tggaaaggataccgcaagtttgcatggggccatgacgagctgaagcctgtgtccaggtcc
ttcagtgagtggtttggcctcggtctcacactgatcgacgcgctggacaccatgtggatc
ttgggtctgaggaaagaatttgaggaagccaggaagtgggtgtcgaagaagttacacttt
gaaaaggacgtggacgtcaacctgtttgagagcacgatccgcatcctgggggggctcctg
agtgcctaccacctgtctggggacagcctcttcctgaggaaagctgaggattttggaaat
cggctaatgcctgccttcagaacaccatccaagattccttactcggatgtgaacatcggt
actggagttgcccacccgccacggtggacctccgacagcactgtggccgaggtgaccagc
attcagctggagttccgggagctctcccgtctcacaggggataagaagtttcaggaggca
gtggagaaggtgacacagcacatccacggcctgtctgggaagaaggatgggctggtgccc
atgttcatcaatacccacagtggcctcttcacccacctgggcgtattcacgctgggcgcc
agggccgacagctactatgagtacctgctgaagcagtggatccagggcgggaagcaggag
acacagctgctggaagactacgtggaagccatcgagggtgtcagaacgcacctgctgcgg
cactccgagcccagtaagctcacctttgtgggggagcttgcccacggccgcttcagtgcc
aagatggaccacctggtgtgcttcctgccagggacgctggctctgggcgtctaccacggc
ctgcccgccagccacatggagctggcccaggagctcatggagacttgttaccagatgaac
cggcagatggagacggggctgagtcccgagatcgtgcacttcaacctttacccccagccg
ggccgtcgggacgtggaggtcaagccagcagacaggcacaacctgctgcggccagagacc
gtggagagcctgttctacctgtaccgcgtcacaggggaccgcaaataccaggactggggc
tgggagattctgcagagcttcagccgattcacacgggtcccctcgggtggctattcttcc
atcaacaatgtccaggatcctcagaagcccgagcctagggacaagatggagagcttcttc
ctgggggagacgctcaagtatctgttcttgctcttctccgatgacccaaacctgctcagc
ctggatgcctacgtgttcaacaccgaagcccaccctctgcctatctggacccctgcctag

KEGG   Homo sapiens (human): 4121
Entry
4121              CDS       T01001                                 

Symbol
MAN1A1, HUMM3, HUMM9, MAN9
Name
(RefSeq) mannosidase alpha class 1A member 1
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4121 (MAN1A1)
   00513 Various types of N-glycan biosynthesis
    4121 (MAN1A1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4121 (MAN1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4121 (MAN1A1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     4121 (MAN1A1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    4121 (MAN1A1)
SSDB
Motif
Pfam: Glyco_hydro_47 AIM5 Glyco_hydro_88 DnaB_bind Endotoxin_C2
Other DBs
NCBI-GeneID: 4121
NCBI-ProteinID: NP_005898
OMIM: 604344
HGNC: 6821
Ensembl: ENSG00000111885
Vega: OTTHUMG00000015472
Pharos: P33908(Tbio)
UniProt: P33908
Position
6q22.31
AA seq 653 aa
MPVGGLLPLFSSPAGGVLGGGLGGGGGRKGSGPAALRLTEKFVLLLVFSAFITLCFGAIF
FLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDN
LARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPI
GVESREPADAAIREKRAKIKEMMKHAWNNYKGYAWGLNELKPISKGGHSSSLFGNIKGAT
IVDALDTLFIMEMKHEFEEAKSWVEENLDFNVNAEISVFEVNIRFVGGLLSAYYLSGEEI
FRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHL
SHLSGNPIFAEKVMNIRTVLNKLEKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLL
KAWLMSDKTDLEAKKMYFDAVQAIETHLIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGG
MFALGADAAPEGMAQHYLELGAEIARTCHESYNRTFMKLGPEAFRFDGGVEAIATRQNEK
YYILRPEVMETYMYMWRLTHDPKYRKWAWEAVEALENHCRVNGGYSGLRDVYLLHESYDD
VQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNSEAHLLPILPKDKKEVEIREE
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgcccgtggggggcctgttgccgctcttcagcagccccgcgggcggcgtcctgggcggg
gggctcggcggcggcggtggcaggaaggggtcgggccccgccgccctccgcctgacggag
aagttcgtgctgctgctggtattcagcgccttcatcacgctctgcttcggggcgatcttc
ttcctgccagactcctccaagctgctcagcggggtcctgttccactccagccccgccttg
cagccggccgccgaccacaagcccgggcccggggcgcgcgccgaggacgcggccgagggg
cgagcccggcgccgcgaggagggggcacccggggacccggaggccgccctggaggacaac
ttggccaggatccgcgaaaaccacgagcgggctctcagggaagccaaggagaccctgcag
aagctgcccgaggagatccaaagagacatcctactggagaagaagaaggtggcccaggac
cagctgcgtgacaaggcgccgttcagaggcctgcccccggtggacttcgtgcccccaatc
ggggtggagagccgggagcccgccgacgccgccatccgcgagaaaagggcaaagatcaaa
gagatgatgaaacatgcttggaataattataaaggttatgcctggggattaaatgaactc
aaacctatatcaaaaggaggccattcaagcagtttgtttggtaacatcaaaggagcaact
atagtagatgccctggatacactttttattatggaaatgaaacatgaatttgaagaagca
aaatcatgggttgaagaaaatttagattttaatgtgaatgctgaaatttctgtctttgaa
gtaaatatacgctttgttggtggactactctcagcctactatctgtctggagaagagatt
tttcgaaagaaagcagtggaacttggggtaaaattgctacctgcatttcatactccctct
ggaataccttgggcattgctgaatatgaaaagtggtattggaaggaactggccctgggcc
tctggaggcagcagtattctggcagaatttggaaccctgcatttggagtttatgcacttg
agccacttatcaggaaaccccatctttgctgaaaaggtaatgaatattcgaacagtactg
aacaaactggaaaaaccacaaggcctttatcctaactatctgaatcccagtagtggacag
tggggtcaacatcatgtatcagttggaggacttggagacagcttctatgagtatttgctg
aaggcctggttaatgtctgacaagacagatctggaagctaagaagatgtattttgatgct
gttcaggctatcgagactcatttgatccgcaagtctagcagcggactaacttatatcgca
gagtggaaagggggcctcctggagcacaagatgggccacctgacctgcttcgcggggggc
atgttcgcactcggggctgatgcagctcccgaaggcatggcccaacactaccttgaactc
ggggctgaaattgcccgtacttgtcatgaatcatataatcgaacatttatgaaactggga
ccagaagctttcagatttgatggtggtgttgaagccatcgctacaagacaaaatgaaaaa
tactacatcttacggccagaagttatggagacttacatgtatatgtggagactgactcat
gatccaaagtacaggaaatgggcctgggaagccgtagaggccttggaaaaccattgcaga
gtgaatggaggctattcaggcctaagggatgtttaccttcttcatgagagttatgatgat
gtgcagcagagtttcttcctggcagagacattgaaatatttgtacctaatattttctgac
gacgatcttcttccactggagcattggatcttcaatagcgaggcacatcttctccctatc
ctccctaaagataaaaaggaagttgaaatcagagaggaataa

KEGG   Homo sapiens (human): 57134
Entry
57134             CDS       T01001                                 

Symbol
MAN1C1, HMIC, MAN1A3, MAN1C, pp6318
Name
(RefSeq) mannosidase alpha class 1C member 1
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00073  N-glycan precursor trimming
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    57134 (MAN1C1)
   00513 Various types of N-glycan biosynthesis
    57134 (MAN1C1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    57134 (MAN1C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57134 (MAN1C1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     57134 (MAN1C1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    57134 (MAN1C1)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 57134
NCBI-ProteinID: NP_065112
OMIM: 616772
HGNC: 19080
Ensembl: ENSG00000117643
Vega: OTTHUMG00000004417
Pharos: Q9NR34(Tdark)
UniProt: Q9NR34 Q59G34
Position
1p36.11
AA seq 630 aa
MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQ
PGLEVVAEIAGHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREE
ATAARGNSIPASRPGDEGVPFRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKE
MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAK
AWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTG
IPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKI
EKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQ
ITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPI
YREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDL
LSLEDWVFNTEAHPLPVNHSDSSGRAWGRH
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgctcatgaggaaagtgcccggcttcgtcccggcctccccgtgggggctgcggctgccg
cagaagttcctcttcctcctcttcctctcgggcctggtcaccctgtgcttcggggccctc
ttcctgctgccccactcctctcgcctcaagcgcctcttcctggccccccggacccagcag
cctggtctggaagtggtggctgaaatcgccggccatgccccggcccgcgagcaggagccg
cctcccaacccggcccccgccgcgccggccccgggcgaggatgaccccagcagctgggcc
agtccccgccgcaggaaaggggggctgcggcgcacccgccccactggaccccgcgaggag
gccacggcggcccggggcaatagcatcccggcctccaggcccggggacgagggcgtccct
ttccgctttgacttcaacgcattccggagccgtctccgccacccggtcctgggaacgagg
gccgatgagagtcaggagccccagagccaagtgcgagcccagcgggagaaaatcaaggag
atgatgcagtttgcttggcagagctataagcgttatgcaatggggaaaaacgaactccgt
ccactaacaaaagatggctacgagggtaacatgttcggaggcctcagcggggcaacagtc
attgactccctcgataccctctacctcatggagctgaaggaggagttccaggaggccaag
gcctgggtgggagagagcttccacctgaacgtgagcggagaagcatccttgtttgaggtg
aacatccgctacatcgggggactcctctcagccttctacctgacaggagaagaggtgttc
cgaataaaggccatcaggctgggagagaagctcctgccggcgttcaacacccccacggga
atcccaaagggcgtggtgagcttcaaaagtgggaactggggctgggccacagccggcagc
agcagcatcttggcggagtttggatccctgcacttggaattcttacacctcactgaactc
tctggcaaccaggtcttcgctgaaaaggtcaggaacatccgcaaggtcctcaggaagatc
gaaaagccctttggcctctaccccaacttcctcagcccagtgagtgggaactgggtgcaa
caccatgtctcagttggaggactcggggacagtttttatgaatatttgatcaaatcctgg
ttgatgtcgggcaagacagatatggaggctaaaaatatgtactacgaagccttggaggcg
atagagacctacttgctgaatgtctctcccggggggctgacctacattgccgagtggcga
ggggggattctggaccacaagatggggcacctggcctgtttctccgggggcatgatcgcc
cttggcgccgaggatgccaaggaagaaaagagggcccactaccgagagctcgcagcccag
atcaccaagacgtgtcacgagtcatacgcccgctcagacaccaaacttgggcctgaggcc
ttctggtttaactccggcagagaggccgtggccacccagctgagcgagagctactacatc
ctccggccagaggtggtggagagctacatgtacctgtggcgacagacccacaaccccatc
tacagggagtggggctgggaggtggtgctggccttggagaaatactgtcggacagaagcc
ggtttctctgggatccaagacgtgtacagtagcacccccaaccacgacaacaagcagcag
agcttctttctagcggagacactaaagtatctctatcttctgttctctgaagatgacttg
ctctccctggaagactgggtgttcaacaccgaggcccacccactcccggtgaaccactca
gacagctccggcagagcctggggcagacactga

DBGET integrated database retrieval system