KEGG   Homo sapiens (human): 10910Help
Entry
10910             CDS       T01001                                 

Gene name
SUGT1, SGT1
Definition
(RefSeq) SGT1 homolog, MIS12 kinetochore complex assembly cochaperone
  KO
K12795  suppressor of G2 allele of SKP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10910 (SUGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SGS CS TPR_2 TPR_17 TPR_19 TPR_16 TPR_1 TPR_8 ANAPC3 CheC TPR_11 TPR_14
Motif
Other DBs
NCBI-GeneID: 10910
NCBI-ProteinID: NP_001124384
OMIM: 604098
HGNC: 16987
Ensembl: ENSG00000165416
Vega: OTTHUMG00000016977
Pharos: Q9Y2Z0(Tbio)
UniProt: Q9Y2Z0 A8K7W3
Structure
PDB: 

Position
13q14.3
AA seq 365 aa AA seqDB search
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcagcaggaactgcaacatcccagaggtttttccagagcttctcggat
gccctaatcgacgaggacccccaggcggcgttagaggagctgactaaggctttggaacag
aaaccagatgatgcacagtattattgtcaaagagcttattgtcacattcttcttgggaat
tactgtgttgctgttgctgatgcaaagaagtctctagaactcaatccaaataattccact
gctatgctgagaaaaggaatatgtgaataccatgaaaaaaactatgctgctgccctagaa
acttttacagaaggacaaaaattagatatagagacggggtttcatcgtgttggccaggct
ggtctccaactcttgacctcaagtgatccacctgccttggactcccaaagtgctgggatt
acaggtgcagatgctaatttcagtgtctggattaaaaggtgtcaagaagctcagaatggc
tcagaatctgaggtgtggactcatcagtcaaaaatcaagtatgactggtatcaaacagaa
tctcaagtagtcattacacttatgatcaagaatgttcagaagaatgatgtaaatgtggaa
ttttcagaaaaagagttgtctgctttggttaaacttccttctggagaggattacaatttg
aaactggaacttcttcatcctataataccagaacagagcacgtttaaagtactttcaaca
aagattgaaattaaactgaaaaagccagaggctgtgagatgggaaaagctagaggggcaa
ggagatgtgcctacgccaaaacaattcgtagcagatgtaaagaacctatatccatcatca
tctccttatacaagaaattgggataaattggttggtgagatcaaagaagaagaaaagaat
gaaaagttggagggagatgcagctttaaacagattatttcagcagatctattcagatggt
tctgatgaagtgaaacgtgccatgaacaaatcctttatggagtcgggtggtacagttttg
agtaccaactggtctgatgtaggtaaaaggaaagttgaaatcaatcctcctgatgatatg
gaatggaaaaagtactaa

DBGET integrated database retrieval system