KEGG   Homo sapiens (human): 10911Help
Entry
10911             CDS       T01001                                 

Gene name
UTS2, PRO1068, U-II, UCN2, UII
Definition
(RefSeq) urotensin 2
  KO
K05248  urotensin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10911 (UTS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Urotensin_II
Motif
Other DBs
NCBI-GeneID: 10911
NCBI-ProteinID: NP_006777
OMIM: 604097
HGNC: 12636
Ensembl: ENSG00000049247
Vega: OTTHUMG00000001218
Pharos: O95399(Tchem)
CPD: C16016
UniProt: O95399
Position
1p36.23
AA seq 124 aa AA seqDB search
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEML
GAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFW
KYCV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctggcctcctgctgtttgcttttcataggattcttaaatcctctcttatct
cttcctctccttgactccagggaaatatcctttcaactctcagcacctcatgaagacgcg
cgcttaactccggaggagctagaaagagcttcccttctacagatactgccagagatgctg
ggtgcagaaagaggggatattctcaggaaagcagactcaagtaccaacatttttaaccca
agaggaaatttgagaaagtttcaggatttctctggacaagatcctaacattttactgagt
catcttttggccagaatctggaaaccatacaagaaacgtgagactcctgattgcttctgg
aaatactgtgtctga

DBGET integrated database retrieval system