KEGG   Homo sapiens (human): 10912Help
Entry
10912             CDS       T01001                                 

Gene name
GADD45G, CR6, DDIT2, GADD45gamma, GRP17
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10912 (GADD45G)
   04068 FoxO signaling pathway
    10912 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10912 (GADD45G)
   04210 Apoptosis
    10912 (GADD45G)
   04115 p53 signaling pathway
    10912 (GADD45G)
   04218 Cellular senescence
    10912 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10912 (GADD45G)
   05202 Transcriptional misregulation in cancer
    10912 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    10912 (GADD45G)
   05212 Pancreatic cancer
    10912 (GADD45G)
   05225 Hepatocellular carcinoma
    10912 (GADD45G)
   05226 Gastric cancer
    10912 (GADD45G)
   05214 Glioma
    10912 (GADD45G)
   05216 Thyroid cancer
    10912 (GADD45G)
   05220 Chronic myeloid leukemia
    10912 (GADD45G)
   05217 Basal cell carcinoma
    10912 (GADD45G)
   05218 Melanoma
    10912 (GADD45G)
   05213 Endometrial cancer
    10912 (GADD45G)
   05224 Breast cancer
    10912 (GADD45G)
   05222 Small cell lung cancer
    10912 (GADD45G)
   05223 Non-small cell lung cancer
    10912 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10912 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10912 (GADD45G)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     10912 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     10912 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 10912
NCBI-ProteinID: NP_006696
OMIM: 604949
HGNC: 4097
Ensembl: ENSG00000130222
Vega: OTTHUMG00000020187
Pharos: O95257(Tbio)
UniProt: O95257
Structure
PDB: 

Position
9q22.2
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

DBGET integrated database retrieval system