KEGG   Homo sapiens (human): 10913Help
Entry
10913             CDS       T01001                                 

Gene name
EDAR, DL, ECTD10A, ECTD10B, ED1R, ED3, ED5, EDA-A1R, EDA1R, EDA3, HRM1
Definition
(RefSeq) ectodysplasin A receptor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00651  Ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10913 (EDAR)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   10913 (EDAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1510 SpoIIIAH TNFR_c6
Motif
Other DBs
NCBI-GeneID: 10913
NCBI-ProteinID: NP_071731
OMIM: 604095
HGNC: 2895
Ensembl: ENSG00000135960
Vega: OTTHUMG00000130982
Pharos: Q9UNE0(Tbio)
UniProt: Q9UNE0
Position
2q13
AA seq 448 aa AA seqDB search
MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSC
GYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSG
QGHLATALIIAMSTIFIMAIAIVLIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKK
EAPDNVVMFSEKDEFEKLTATPAKPTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESLCADILEWAGVVPPASQPHAAS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgtgggggactgcacgcagacgccctggctccccgtcctggtggtgtctctg
atgtgctcagcccgagcggaatactcaaactgcggtgagaacgagtactacaaccagact
acggggctgtgccaggagtgccccccgtgtgggccgggagaggagccctacctgtcctgt
ggctacggcaccaaagacgaggactacggctgcgtcccctgcccggcggagaagttttcc
aaaggaggctaccagatatgcaggcgtcacaaagactgtgagggcttcttccgggccacc
gtgctgacaccaggggacatggagaatgacgctgagtgtggcccttgcctccctggctac
tacatgctggagaacagaccgaggaacatctatggcatggtctgctactcctgcctcctg
gcaccccccaacaccaaggaatgtgtgggagccacttcaggagcttctgccaacttccct
ggcacctcgggcagcagcaccctgtctcccttccagcacgcccacaaagaactctcaggc
caaggacacctggccactgccctgatcattgcaatgtccaccatcttcatcatggccatc
gccatcgtcctcatcatcatgttctacatcctgaagacaaagccctctgccccagcctgt
tgcaccagccacccggggaagagcgtggaggcccaagtgagcaaggacgaggagaagaaa
gaggccccagacaacgtggtgatgttctccgagaaggatgaatttgagaagctgacagca
actccagcaaagcccaccaagagcgagaacgatgcctcatccgagaatgagcagctgctg
agccggagcgtcgacagtgatgaggagcccgcccctgacaagcagggctccccggagctg
tgcctgctgtcgctggttcacctggccagggagaagtctgccaccagcaacaagtcagcc
gggattcaaagccggaggaaaaagatcctcgatgtgtatgccaacgtgtgtggagtcgtg
gaaggtcttagccccacggagctgccatttgattgcctcgagaagactagccgaatgctc
agctccacgtacaactctgagaaggctgttgtgaaaacgtggcgccacctcgccgagagc
ttcggcctgaagagggatgagattgggggcatgacagacggcatgcaactctttgaccgc
atcagcacggcaggctacagcatccctgagctactcacaaaactggtgcagattgagcgg
ctggatgctgtggagtccttgtgtgcagacatactggagtgggcgggggttgtgccacct
gcctcccagccacatgctgcatcctga

DBGET integrated database retrieval system