KEGG   Homo sapiens (human): 10914Help
Entry
10914             CDS       T01001                                 

Gene name
PAPOLA, PAP, PAP-alpha
Definition
(RefSeq) poly(A) polymerase alpha
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    10914 (PAPOLA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10914 (PAPOLA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     10914 (PAPOLA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     10914 (PAPOLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Polbeta
Motif
Other DBs
NCBI-GeneID: 10914
NCBI-ProteinID: NP_116021
OMIM: 605553
HGNC: 14981
Ensembl: ENSG00000090060
Vega: OTTHUMG00000171441
Pharos: P51003(Tbio)
UniProt: P51003 A0A024R6M3
Position
14q32.2
AA seq 745 aa AA seqDB search
MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQR
RILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVA
PRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPE
DLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNI
LGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVW
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSK
LFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQS
FPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVD
MKIAAMHVKRKQLHQLLPNHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTS
ATKTSPLNSSGSSQGRNSPAPAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTAT
QPAISPPPKPTVSRVVSSTRLVNPPPRSSGNAATSGNAATKIPTPIVGVKRTSSPHKEES
PKKTKTEEDETSEDANCLALSGHDKTEAKEQLDTETSTTQSETIQTAASLLASQKTSSTD
LSDIPALPANPIPVIKNSIKLRLNR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttccagttacaacacagggatcacaacaaacacaaccgccacagaagcactat
ggcattacttctcctatcagcttagcagcccccaaggagactgactgcgtacttacacag
aaactaattgagacattgaaaccctttggggtttttgaagaggaagaggaactgcagcgc
aggattttaattttgggaaaactaaataacctggtaaaagagtggatacgagaaatcagt
gaaagcaagaatcttccacaatctgtaattgaaaatgttggaggaaaaatttttacattt
ggatcttacagattaggagtgcatacaaaaggtgctgatattgatgcgttgtgtgttgca
ccaagacatgttgatcgaagtgactttttcacctcattctatgataagttgaaattacag
gaagaagtaaaagatttaagagctgttgaagaggcattcgtaccagttattaaactctgt
tttgatgggatagagattgatattttgtttgcaagattagcactgcagacaattcctgaa
gatttggatctacgagatgacagtctgctaaaaaatttagatataagatgtataagaagt
cttaacggttgcagggtaaccgatgaaattttacatctagtaccaaacattgacaacttc
aggttaactctgagagctatcaaactatgggccaaacgccacaacatctattccaatata
ttaggtttcctcggtggtgtttcctgggctatgctagtagcaagaacttgccagctttat
ccaaatgcaatagcatcaactcttgtacataaatttttcttggtattttctaaatgggaa
tggccaaatccagtgctattgaaacagcctgaagaatgcaatcttaatttgcctgtatgg
gacccaagggtaaaccccagtgataggtaccatcttatgcctataattacaccagcatac
ccacaacagaactccacgtacaatgtgtccgtttcaacacggatggtcatggttgaggag
tttaaacaaggtcttgctatcacagatgaaattttgctgagtaaggcagagtggtccaaa
ctttttgaagctccaaacttctttcaaaagtacaagcattatattgtacttctagcaagt
gcaccaacagaaaaacaacgcctggaatgggtgggcttggtggaatcaaaaatccgaatc
ctggttggaagcttggagaagaatgaatttattacactggctcatgtgaatccccagtca
tttccagcacccaaagaaaatcccgacaaggaagaatttcgcacgatgtgggtgattggg
ttagtgtttaaaaaaacagaaaactctgaaaacctcagtgttgatctcacctatgatatt
cagtctttcacagatacagtttataggcaagcaataaacagcaagatgtttgaggtggat
atgaaaattgctgcaatgcatgtaaaaagaaagcaactccatcaactactacctaatcat
gtgcttcagaaaaagaaaaagcattcaacagaaggtgtcaaattgacagctctcaatgac
agcagcctcgacttgtctatggacagtgataacagcatgtctgtgccttcacctactagt
gctacgaagaccagtccattgaacagttctggcagctctcagggcagaaacagtcctgct
ccagctgtaacagcagcatctgtgaccaacatacaggctactgaagtttctgtgccacaa
gtaaattccagtgaaagctcagggggtacatcgagtgaaagcattcctcaaactgccaca
caaccagccatttctccaccaccaaagcctacggtctccagagttgtttcttcaacacgt
ctggtaaacccaccacctagatcttcaggaaatgcagcaacttcaggaaatgcagcaaca
aaaatacctactcctatagtaggagtcaagaggacatcctcacctcataaagaagagagt
cccaagaaaaccaaaacagaagaggatgaaacaagtgaagatgctaactgtcttgctttg
agtggacatgataaaacagaagcaaaggaacaacttgatacagagacaagtacaactcaa
tcagaaactattcagacagcggcttctctgttggcctctcagaaaacatccagtacagac
ctttctgatatccctgctctccctgcaaatcctattcctgttatcaagaattcaataaaa
ctgagattgaatcggtaa

DBGET integrated database retrieval system