KEGG   Homo sapiens (human): 10920
Entry
10920             CDS       T01001                                 
Symbol
COPS8, COP9, CSN8, SGN8
Name
(RefSeq) COP9 signalosome subunit 8
  KO
K12181  COP9 signalosome complex subunit 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10920 (COPS8)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    10920 (COPS8)
SSDB
Motif
Pfam: CSN8_PSD8_EIF3K PCI
Other DBs
NCBI-GeneID: 10920
NCBI-ProteinID: NP_006701
OMIM: 616011
HGNC: 24335
Ensembl: ENSG00000198612
Pharos: Q99627(Tbio)
UniProt: Q99627 A0A024R4D1
Structure
Position
2:237085889..237100474
AA seq 209 aa
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRI
PPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFAL
VSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI
PLSEPAPVPPIPNEQQLARLTDYVAFLEN
NT seq 630 nt   +upstreamnt  +downstreamnt
atgccagtggcggtgatggcggaaagcgcctttagtttcaaaaagttgctggatcagtgc
gagaaccaggagctcgaggcccctggaggaattgctacacccccagtgtatggtcagctt
ctagctttatatttgctccataatgacatgaataatgcaagatatctttggaaaagaata
ccacctgctataaaatctgcaaattctgaacttgggggaatttggtcagtaggacaaaga
atctggcagagagatttccctgggatctatacaaccatcaacgctcaccagtggtctgag
acggtccagccaattatggaagcacttagagatgcaacaaggagacgcgcctttgccctg
gtctctcaagcgtatacttcaatcatcgccgatgattttgcagcctttgttggacttcct
gtagaagaggctgtgaaaggcatattagaacaaggatggcaagctgattccaccacaaga
atggttctgcccagaaagccagttgcaggggccctggatgtttcctttaacaagtttatt
cccttatcagagcctgctccagttcccccaatacccaatgaacagcagttagccagactg
acggattatgtggctttccttgaaaactga

DBGET integrated database retrieval system