KEGG   Homo sapiens (human): 10921
Entry
10921             CDS       T01001                                 

Symbol
RNPS1, E5.1
Name
(RefSeq) RNA binding protein with serine rich domain 1
  KO
K14325  RNA-binding protein with serine-rich domain 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    10921 (RNPS1)
   03015 mRNA surveillance pathway
    10921 (RNPS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10921 (RNPS1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10921 (RNPS1)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 RRM_3 Nup35_RRM_2 RRM_occluded Macoilin LAP1C
Other DBs
NCBI-GeneID: 10921
NCBI-ProteinID: NP_001273554
OMIM: 606447
HGNC: 10080
Ensembl: ENSG00000205937
Vega: OTTHUMG00000128828
Pharos: Q15287(Tbio)
UniProt: Q15287 D3DU92
Structure
PDB: 
4A8X

Position
16p13.3
AA seq 305 aa
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD
KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggatttatcaggagtgaaaaagaagagcttgctaggagtcaaagaaaataataaaaag
tccagcactagggctccttcacctaccaaacgcaaagaccgctcagatgagaagtccaag
gatcgctcaaaagataaaggggccaccaaggagtcgagtgagaaggatcgcggccgggac
aaaacccgaaagaggcgcagcgcttccagtggtagcagcagtaccaggtctcggtccagc
tcgacttccagctcaggctccagcaccagcactggctcaagcagtggctccagctcttcc
tcagcatccagccgctcaggaagctccagcacctcccgcagctccagctctagcagctct
tctggctctccaagtccttctcggcgcagacacgacaacaggaggcgctcccgctccaaa
tccaaaccacctaaaagagatgaaaaggagaggaaaaggcggagcccatctcctaagccc
accaaagtgcacattgggagactcacccggaatgtgacaaaggatcacatcatggagata
ttttccacctatgggaaaattaaaatgattgacatgcccgtggaaaggatgcatccccat
ctgtccaaaggctatgcgtacgtagagtttgagaatccagatgaagccgagaaggcgctg
aagcacatggatggaggacaaattgatggccaggagatcactgccaccgccgtgctggcc
ccctggcctaggccaccccccaggagattcagccctcccaggagaatgttgccaccaccg
cctatgtggcgcaggtctcccccacggatgaggagaaggtcccgctccccgaggcgcagg
tcccccgtgcgccggagatcacggtccccgggccgccgccgccacaggagccgctccagc
tccaactcctcccgataa

DBGET integrated database retrieval system