KEGG   Homo sapiens (human): 10936Help
Entry
10936             CDS       T01001                                 

Gene name
GPR75, GPRchr2, WI31133
Definition
(RefSeq) G protein-coupled receptor 75
  KO
K08417  G protein-coupled receptor 75
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10936 (GPR75)
   04050 Cytokine receptors [BR:hsa04050]
    10936 (GPR75)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    10936 (GPR75)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   10936 (GPR75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 10936
NCBI-ProteinID: NP_006785
OMIM: 606704
HGNC: 4526
Ensembl: ENSG00000119737
Vega: OTTHUMG00000129280
Pharos: O95800(Tdark)
UniProt: O95800
Position
2p16.2
AA seq 540 aa AA seqDB search
MNSTGHLQDAPNATSLHVPHSQEGNSTSLQEGLQDLIHTATLVTCTFLLAVIFCLGSYGN
FIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFVLFFSSASSIPDAFCFT
FHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTVLLTLLLWATSFTLATLAT
LKTSKSHLCLPMSSLIAGKGKAILSLYVVDFTFCVAVVSVSYIMIAQTLRKNAQVRKCPP
VITVDASRPQPFMGVPVQGGGDPIQCAMPALYRNQNYNKLQHVQTRGYTKSPNQLVTPAA
SRLQLVSAINLSTAKDSKAVVTCVIIVLSVLVCCLPLGISLVQVVLSSNGSFILYQFELF
GFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRN
KSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIE
PYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaacaggccaccttcaggatgcccccaatgccacctcgctccatgtgcctcac
tcacaggaaggaaacagcacctctctccaggagggtcttcaggatctcatccacacagcc
accttggtgacctgtacttttctactggcggtcatcttctgcctgggttcctatggcaac
ttcattgtcttcttgtccttcttcgatccagccttcaggaaattcagaaccaactttgat
ttcatgatcctgaacctgtccttctgtgacctcttcatttgtggagtgacagcccccatg
ttcacctttgtgttattcttcagctcagccagtagtatcccggatgctttctgcttcact
ttccatctcaccagttcaggcttcatcatcatgtctctgaagacagtggcagtgatcgcc
ctgcaccggctccggatggtgttggggaaacagcctaatcgcacggcctcctttccctgc
accgtactcctcaccctgcttctctgggccaccagtttcacccttgccaccttggctacc
ttgaaaaccagcaagtcccacctctgtcttcccatgtccagtctgattgctggaaaaggg
aaagccattttgtctctctatgtggtcgacttcaccttctgtgttgctgtggtctctgtc
tcttacatcatgattgctcagaccctgcggaagaacgctcaagtcagaaagtgcccccct
gtaatcacagtcgatgcttccagaccacagcctttcatgggggtccctgtgcagggaggt
ggagatcccatccagtgtgccatgccggctctgtataggaaccagaattacaacaaactg
cagcacgttcagacccgtggatataccaagagtcccaaccaactggtcacccctgcagca
agccgactccagctcgtatcagccatcaacctctccactgccaaggattccaaagccgtg
gtcacctgtgtgatcattgtgctgtcagtcctggtgtgctgtcttccactggggatttcc
ttggtacaggtggttctctccagcaatgggagcttcattctttaccagtttgaattgttt
ggatttactcttatatttttcaagtcaggattaaacccttttatatattctcggaacagt
gcagggctgagaaggaaagtgctctggtgcctccaatacataggcctgggttttttctgc
tgcaaacaaaagactcgacttcgagccatgggaaaagggaacctcgaagtcaacagaaac
aaatcctcccatcatgaaacaaactctgcctacatgttatctccaaagccacagaagaaa
tttgtggaccaggcttgtggcccaagtcattcaaaagaaagtatggtgagtcccaagatc
tctgctggacatcaacactgtggtcagagcagctcgacccccatcaacactcggattgaa
ccttactacagcatctataacagcagcccttcccaggaggagagcagcccatgtaactta
cagccagtaaactcttttggatttgccaattcatatattgccatgcattatcacaccact
aatgacttagtgcaggaatatgacagcacttcagccaagcagattccagtcccctccgtt
taa

DBGET integrated database retrieval system