KEGG   Homo sapiens (human): 10945
Entry
10945             CDS       T01001                                 
Symbol
KDELR1, ERD2, ERD2.1, HDEL, PM23
Name
(RefSeq) KDEL endoplasmic reticulum protein retention receptor 1
  KO
K10949  ER lumen protein retaining receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05110  Vibrio cholerae infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    10945 (KDELR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10945 (KDELR1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    10945 (KDELR1)
SSDB
Motif
Pfam: ER_lumen_recept PQ-loop
Other DBs
NCBI-GeneID: 10945
NCBI-ProteinID: NP_006792
OMIM: 131235
HGNC: 6304
Ensembl: ENSG00000105438
Pharos: P24390(Tbio)
UniProt: P24390
Position
19:complement(48382575..48397412)
AA seq 212 aa
MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN
TCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILW
TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA
IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaatctcttccgattcctgggagacctctcccacctcctcgccatcatcttgctactg
ctcaaaatctggaagtcccgctcgtgcgccggaatttcagggaagagccaggtcctgttt
gctgtggtgttcactgcccgatatctggacctcttcaccaactacatctcactctacaac
acgtgtatgaaggtggtctacatagcctgctccttcaccacggtctggttgatttatagc
aagttcaaagctacttacgatgggaaccatgacacgttcagagtggagttcctggtcgtt
cccacagccattctggcgttcctggtcaatcatgacttcacccctctggagatcctctgg
accttctccatctacctggagtcagtggccatcttgccgcagctgttcatggtgagcaag
accggcgaggcggagaccatcaccagccactacttgtttgcgctaggcgtttaccgcacg
ctctatctcttcaactggatctggcgctaccatttcgagggcttcttcgacctcatcgcc
attgtggcaggcctggtccagacagtcctctactgcgatttcttctacctctatatcacc
aaagtcctaaaggggaagaagttgagtttgccggcatag

DBGET integrated database retrieval system