KEGG   Homo sapiens (human): 10946
Entry
10946             CDS       T01001                                 

Gene name
SF3A3, PRP9, PRPF9, SAP61, SF3a60
Definition
(RefSeq) splicing factor 3a subunit 3
  KO
K12827  splicing factor 3A subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10946 (SF3A3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10946 (SF3A3)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    10946 (SF3A3)
 Complex B
    10946 (SF3A3)
 Complex C
   U2 SnRNP specific factors
    10946 (SF3A3)
SSDB
Motif
Pfam: DUF3449 Telomere_Sde2_2 SF3A3 SF3a60_bindingd zf-met
Other DBs
NCBI-GeneID: 10946
NCBI-ProteinID: NP_006793
OMIM: 605596
HGNC: 10767
Ensembl: ENSG00000183431
Vega: OTTHUMG00000004438
Pharos: Q12874(Tbio)
UniProt: Q12874
Structure
PDB: 
6FF7 5Z58 6AH0 2DT7

Position
1p34.3
AA seq 501 aa
METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDL
YDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENP
SEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNA
EYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHA
GAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSL
FAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEE
EEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYE
DSSGNVVNKKTYEDLKRQGLL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggagacaatactggagcagcagcggcgctatcatgaggagaaggaacggctcatggac
gtcatggctaaagagatgctcaccaagaagtccacgctccgggaccagatcaattctgat
caccgcactcgggccatgcaagataggtatatggaggtcagtgggaacctgagggatttg
tatgatgataaggatggattacgaaaggaggagctcaatgccatttcaggacccaatgag
tttgctgaattctataatagactcaagcaaataaaggaattccaccggaagcacccaaat
gagatctgtgtgccaatgtcagtggaatttgaggaactcctgaaggctcgagagaatcca
agtgaagaggcacaaaacttggtggagttcacagatgaagagggatatggtcgttatctc
gatctccatgactgttacctcaagtacattaacctgaaggcatctgagaagctggattat
atcacatacctgtccatctttgaccaattatttgacattcctaaagaaaggaagaatgca
gagtataagagatacctagagatgctgcttgagtaccttcaggattacacagatagagtg
aagcctctccaagatcagaatgaactttttgggaagattcaggctgagtttgagaagaaa
tgggagaatgggacctttcctggatggccgaaagagacaagcagtgccctgacccatgct
ggagcccatcttgacctctctgcattctcctcctgggaggagttggcttctctgggtttg
gacagattgaaatctgctctcttagctttaggcttgaaatgtggcgggaccctagaagag
cgagcccagagactattcagtaccaaaggaaagtccctggagtcacttgatacctctttg
tttgccaaaaatcccaagtcaaagggcaccaagcgagacactgaaaggaacaaagacatt
gcttttctagaagcccagatctatgaatatgtagagattctcggggaacagcgacatctc
actcatgaaaatgtacagcgcaagcaagccaggacaggagaagagcgagaagaagaggaa
gaagagcagatcagtgagagtgagagtgaagatgaagagaacgagatcatttacaacccc
aaaaacctgccacttggctgggatggcaaacctattccctactggctgtataagcttcat
ggcctaaatatcaactacaactgtgagatttgtggaaactacacctaccgagggcccaaa
gccttccagcgacactttgctgaatggcgtcatgctcatggcatgaggtgtttgggcatc
ccaaacactgctcactttgctaatgtgacacagattgaagatgctgtctccttgtgggcc
aaactgaaattgcagaaggcttcagaacgatggcagcctgacactgaggaagaatatgaa
gactcaagtgggaatgttgtgaataagaagacatacgaggatctgaaaagacaaggactg
ctctag

DBGET integrated database retrieval system