KEGG   Homo sapiens (human): 10947
Entry
10947             CDS       T01001                                 
Symbol
AP3M2, AP47B, CLA20, P47B
Name
(RefSeq) adaptor related protein complex 3 subunit mu 2
  KO
K12398  AP-3 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    10947 (AP3M2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10947 (AP3M2)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    10947 (AP3M2)
 Endosome - Golgi transport
    10947 (AP3M2)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF11
Other DBs
NCBI-GeneID: 10947
NCBI-ProteinID: NP_001127768
OMIM: 610469
HGNC: 570
Ensembl: ENSG00000070718
Pharos: P53677(Tdark)
UniProt: P53677 A0A384NYL6
Position
8:42153063..42171183
AA seq 418 aa
MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVY
RHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNG
FPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAY
FDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFK
RWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQT
MGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSL
QAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatccatagtcttttcttgatcaactcctctggagacattttcctggagaaacattgg
aaaagtgtggtcagccgttctgtttgtgattacttttttgaggcgcaagagagagctact
gaggcagaaaatgtgcctccggttatccctacccctcaccactatctcttaagtgtttac
cgccacaagatcttttttgtggccgtgatccagacggaggtcccccctctgtttgtcatt
gagtttcttcaccgagtggtggacacatttcaggattattttggagtctgttcagagcca
gtgatcaaagacaatgtagttgtggtttatgaggtattggaagagatgcttgacaatggt
tttccattggctaccgagtcgaacattcttaaagaactcataaagcctcctaccatcctt
cgaacggttgtcaacaccatcacaggaagcacgaatgtgggtgaccagcttcccactggg
cagctgtcagtggtgccttggcgacggactggggtgaaatataccaacaatgaggcctat
tttgatgtgattgaagagattgatgcaattattgataaatcaggctccacaattactgct
gagatccagggggtgattgatgcctgtgtcaagctgactggcatgccagaccttacactt
tccttcatgaaccctaggttgttggatgatgtcagcttccatccttgtgttcgtttcaaa
cgctgggaatctgagcgcatcctctccttcatccctcctgatggaaacttccgcctgctg
tcttaccatgtcagtgcacagaatctggttgcaatcccagtgtatgtcaaacataacatc
agtttccgggacagtagttcccttggacgctttgaaataacggtgggacccaagcagacg
atggggaagaccattgagggagtgactgtcaccagccagatgcccaagggggtcctgaac
atgagccttactccatcacaggggacacacacattcgacccagtcacaaagatgctgtct
tgggatgtaggaaaaataaatccacaaaagctaccaagtttgaaggggaccatgagtctt
caggctggagcttccaaaccagatgaaaaccccacaattaacctgcagtttaagatccag
cagctggccatttctggactcaaggtgaatcgtctggatatgtatggagaaaagtacaaa
ccctttaagggcataaaatacatgaccaaagctgggaagttccaagttcgaacctga

DBGET integrated database retrieval system