KEGG   Homo sapiens (human): 10951Help
Entry
10951             CDS       T01001                                 

Gene name
CBX1, CBX, HP1-BETA, HP1Hs-beta, HP1Hsbeta, M31, MOD1, p25beta
Definition
(RefSeq) chromobox 1
  KO
K11585  chromobox protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10951 (CBX1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   HP1 (heterochromatin protein 1)
    10951 (CBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo_shadow Chromo Mtf2_C
Motif
Other DBs
NCBI-GeneID: 10951
NCBI-ProteinID: NP_001120700
OMIM: 604511
HGNC: 1551
Ensembl: ENSG00000108468
Vega: OTTHUMG00000150417
Pharos: P83916(Tbio)
UniProt: P83916 Q6IBN6
Structure
PDB: 

Position
17q21.32
AA seq 185 aa AA seqDB search
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPE
RIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK
KDDKN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaaacaaaacaagaagaaagtggaggaggtgctagaagaggaggaagaggaa
tatgtggtggaaaaagttctcgaccgtcgagtggtaaagggcaaagtggagtacctccta
aagtggaagggattctcagatgaggacaacacatgggagccagaagagaacctggattgc
cccgacctcattgctgagtttctgcagtcacagaaaacagcacatgagacagataaatca
gagggaggcaagcgcaaagctgattctgattctgaagataagggagaggagagcaaacca
aagaagaagaaagaagagtcagaaaagccacgaggctttgctcgaggtttggagccggag
cggattattggagctacagactccagtggagagctcatgttcctgatgaaatggaaaaac
tctgatgaggctgacctggtccctgccaaggaagccaatgtcaagtgcccacaggttgtc
atatccttctatgaggaaaggctgacgtggcattcctacccctcggaggatgatgacaaa
aaagatgacaagaactaa

DBGET integrated database retrieval system