KEGG   Homo sapiens (human): 10952
Entry
10952             CDS       T01001                                 

Gene name
SEC61B
Definition
(RefSeq) SEC61 translocon subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    10952 (SEC61B)
   04141 Protein processing in endoplasmic reticulum
    10952 (SEC61B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10952 (SEC61B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    10952 (SEC61B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    10952 (SEC61B)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   10952 (SEC61B)
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 10952
NCBI-ProteinID: NP_006799
OMIM: 609214
HGNC: 16993
Ensembl: ENSG00000106803
Vega: OTTHUMG00000020354
Pharos: P60468(Tbio)
UniProt: P60468
Position
9q22.33
AA seq 96 aa
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 291 nt   +upstreamnt  +downstreamnt
atgcctggtccgacccccagtggcactaacgtgggatcctcagggcgctctcccagcaaa
gcagtggccgcccgggcggcgggatccactgtccggcagaggaaaaatgccagctgtggg
acaaggagtgcaggccgcacaacctcggcaggcaccggggggatgtggcgattctacaca
gaagattcacctgggctcaaagttggccctgttccagtattggttatgagtcttctgttc
atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

DBGET integrated database retrieval system