KEGG   Homo sapiens (human): 10959
Entry
10959             CDS       T01001                                 

Gene name
TMED2, P24A, RNP24, p24, p24b1, p24beta1
Definition
(RefSeq) transmembrane p24 trafficking protein 2
  KO
K20347  p24 family protein beta-1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10959 (TMED2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10959 (TMED2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    10959 (TMED2)
Transporters [BR:hsa02000]
 Other transporters
  Others
   10959 (TMED2)
SSDB
Motif
Pfam: EMP24_GP25L TerD SdrD_B
Other DBs
NCBI-GeneID: 10959
NCBI-ProteinID: NP_006806
HGNC: 16996
Ensembl: ENSG00000086598
Vega: OTTHUMG00000168694
Pharos: Q15363(Tbio)
UniProt: Q15363 Q6FHT8
Structure
PDB: 
5AZW

Position
12q24.31
AA seq 201 aa
MVTLAELLVLLAALLATVSGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVE
ITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD
METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL
VAMTLGQIYYLKRFFEVRRVV
NT seq 606 nt   +upstreamnt  +downstreamnt
atggtgacgcttgctgaactgctggtgcttctggccgctctcctggccacggtctcgggc
tatttcgttagcatcgacgcccatgctgaagagtgcttctttgagcgggtcacctcgggc
accaagatgggcctcatcttcgaggtggcggagggcggcttcctggacatcgacgtggag
attacaggaccagataacaaaggaatttacaaaggagacagagaatccagtgggaaatac
acatttgctgctcacatggatggaacatacaaattttgttttagtaaccggatgtccacc
atgactccaaaaatagtgatgttcaccattgatattggggaggctccaaaaggacaagat
atggaaacagaagctcaccagaacaagctagaagaaatgatcaatgagctagcagtggcg
atgacagctgtaaagcacgaacaggaatacatggaagtccgggagagaatacacagagcc
atcaacgacaacacaaacagcagagtggtcctttggtccttctttgaagctcttgttcta
gttgccatgacattgggacagatctactacctgaagagattttttgaagtccggagagtt
gtttaa

DBGET integrated database retrieval system