KEGG   Homo sapiens (human): 10960
Entry
10960             CDS       T01001                                 

Gene name
LMAN2, C5orf8, GP36B, VIP36
Definition
(RefSeq) lectin, mannose binding 2
  KO
K10082  lectin, mannose-binding 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10960 (LMAN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10960 (LMAN2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    10960 (LMAN2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    10960 (LMAN2)
Lectins [BR:hsa04091]
 L-type lectins
  10960 (LMAN2)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin
Other DBs
NCBI-GeneID: 10960
NCBI-ProteinID: NP_006807
OMIM: 609551
HGNC: 16986
Ensembl: ENSG00000169223
Vega: OTTHUMG00000130860
Pharos: Q12907(Tbio)
UniProt: Q12907 A0A384NPY7
Position
5q35.3
AA seq 356 aa
MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSL
IKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKV
HGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVM
VNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCI
DITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLK
SPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQERNKRFY
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcggcggaaggctggatttggcgttggggctggggccggcggtgcctgggaaggcct
gggcttctcggccccggccctggccccactacacctctctttcttcttttgttgttgggg
tctgtgactgcggatataactgacggcaacagtgaacatctcaagcgggagcattcgctc
attaagccctaccaaggggtcggttccagctctatgcccctctgggacttccagggcagc
actatgctcacgagccagtacgtacgtctgacccctgacgagcgcagcaaagagggctct
atctggaaccaccagccgtgcttcctcaaagactgggaaatgcacgtccacttcaaagtc
cacggcacagggaagaagaacctccatggagacggcatcgccttgtggtacacccgggac
cgcctcgtgccagggcctgtgtttggaagcaaagataacttccacggcttagccatcttc
ctggacacctaccccaatgatgagaccactgagcgcgtgttcccgtacatctcggtgatg
gtgaacaatggctccctgtcctacgaccacagcaaggatgggcgctggaccgagctggcg
ggctgcacggctgacttccgcaaccgcgatcacgacaccttcctggctgtgcgctactcc
cggggccgtctgacggtgatgaccgacctggaggacaagaacgagtggaagaactgcatt
gacatcacgggagtgcgcctgcccaccggctactacttcggggcctccgccggcaccggc
gacctgtctgacaatcatgacatcatctccatgaagctgttccagctgatggtggagcac
acgcccgacgaggagagcatcgactggaccaagatcgagcccagcgtcaacttcctcaag
tcgcccaaagacaacgtggacgaccccacggggaacttccgcagcgggcccctgacgggg
tggcgggtgttcctgctgctgctgtgcgctctcctgggcatcgttgtctgcgccgtggtg
ggggccgtggtgttccagaagcggcaggagcggaacaagcgcttctactga

DBGET integrated database retrieval system