KEGG   Homo sapiens (human): 10961Help
Entry
10961             CDS       T01001                                 

Gene name
ERP29, C12orf8, ERp28, ERp31, HEL-S-107, PDI-DB, PDIA9
Definition
(RefSeq) endoplasmic reticulum protein 29
  KO
K09586  endoplasmic reticulum protein 29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10961 (ERP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10961 (ERP29)
   04131 Membrane trafficking [BR:hsa04131]
    10961 (ERP29)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   10961 (ERP29)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    10961 (ERP29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERp29_N ERp29
Motif
Other DBs
NCBI-GeneID: 10961
NCBI-ProteinID: NP_006808
OMIM: 602287
HGNC: 13799
Ensembl: ENSG00000089248
Vega: OTTHUMG00000169637
Pharos: P30040(Tbio)
UniProt: P30040 V9HW71
Structure
PDB: 

Position
12q24.13
AA seq 261 aa AA seqDB search
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQAL
LKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctgtgccccgcgccgcatttctctccccgctgcttccccttctcctgggc
ttcctgctcctctccgctccgcatggcggcagcggcctgcacaccaagggcgcccttccc
ctggatacggtcactttctacaaggtcattcccaaaagcaagttcgtcttggtgaagttc
gacacccagtacccctacggtgagaagcaggatgagttcaagcgtcttgctgaaaactcg
gcttccagcgatgatctcttggtggcagaggtggggatctcagattatggtgacaagctg
aacatggagctgagtgagaaatacaagctggacaaagagagctacccagtcttctacctc
ttccgggatggggactttgagaacccagtcccatacactggggcagttaaggttggagcc
atccagcgctggctgaaggggcaaggggtctacctaggtatgcctggttgcctgcctgta
tacgacgccctggccggggagttcatcagggcctctggtgtggaggcccgccaggccctc
ttgaagcaggggcaagataacctctcaagtgtgaaggagactcagaagaagtgggccgag
caatacctgaagatcatggggaagatcttagaccaaggggaggacttcccagcatcagag
atgacacggatcgccaggctgattgagaagaacaagatgagtgacgggaagaaggaggag
ctccagaagagcttaaacatcctgactgccttccagaagaagggggccgagaaagaggag
ctgtaa

DBGET integrated database retrieval system