KEGG   Homo sapiens (human): 10963Help
Entry
10963             CDS       T01001                                 

Gene name
STIP1, HEL-S-94n, HOP, IEF-SSP-3521, P60, STI1, STI1L
Definition
(RefSeq) stress induced phosphoprotein 1
  KO
K09553  stress-induced-phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05020 Prion diseases
    10963 (STIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10963 (STIP1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Sti1 / p60
   10963 (STIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_12 TPR_14 TPR_16 TPR_19 TPR_17 TPR_7 TPR_9 TPR_10 NARP1 ANAPC3 TPR_3 MIT TPR_20 Wtap Alkyl_sulf_dimr
Motif
Other DBs
NCBI-GeneID: 10963
NCBI-ProteinID: NP_006810
OMIM: 605063
HGNC: 11387
Ensembl: ENSG00000168439
Vega: OTTHUMG00000167789
Pharos: P31948(Tbio)
UniProt: P31948 V9HW72
Structure
PDB: 

Position
11q13.1
AA seq 543 aa AA seqDB search
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
VLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggtcaatgagctgaaggagaaaggcaacaaggccctgagcgtgggtaacatc
gatgatgccttacagtgctactccgaagctattaagctggatccccacaaccacgtgctg
tacagcaaccgttctgctgcctatgccaagaaaggagactaccagaaggcttatgaggat
ggctgcaagactgtcgacctaaagcctgactggggcaagggctattcacgaaaagcagca
gctctagagttcttaaaccgctttgaagaagccaagcgaacctatgaggagggcttaaaa
cacgaggcaaataaccctcaactgaaagagggtttacagaatatggaggccaggttggca
gagagaaaattcatgaaccctttcaacatgcctaatctgtatcagaagttggagagtgat
cccaggacaaggacactactcagtgatcctacctaccgggagctgatagagcagctacga
aacaagccttctgacctgggcacgaaactacaagatccccggatcatgaccactctcagc
gtcctccttggggtcgatctgggcagtatggatgaggaggaagagattgcaacacctcca
ccaccaccccctcccaaaaaggagaccaagccagagccaatggaagaagatcttccagag
aataagaagcaggcactgaaagaaaaagagctggggaacgatgcctacaagaagaaagac
tttgacacagccttgaagcattacgacaaagccaaggagctggaccccactaacatgact
tacattaccaatcaagcagcggtatactttgaaaagggcgactacaataagtgccgggag
ctttgtgagaaggccattgaagtggggagagaaaaccgagaagactatcgacagattgcc
aaagcatatgctcgaattggcaactcctacttcaaagaagaaaagtacaaggatgccatc
catttctataacaagtctctggcagagcaccgaaccccagatgtgctcaagaaatgccag
caggcagagaaaatcctgaaggagcaagagcggctggcctacataaaccccgacctggct
ttggaggagaagaacaaaggcaacgagtgttttcagaaaggggactatccccaggccatg
aagcattatacagaagccatcaaaaggaacccgaaagatgccaaattatacagcaatcga
gctgcctgctacaccaaactcctggagttccagctggcactcaaggactgtgaggaatgt
atccagctggagccgaccttcatcaagggttatacacggaaagccgctgcgctggaagcg
atgaaggactacaccaaagccatggatgtgtaccagaaggcgctagacctggactccagc
tgtaaggaggcggcagacggctaccagcgctgtatgatggcgcagtacaaccggcacgac
agccccgaagatgtgaagcgacgagccatggccgaccctgaggtgcagcagatcatgagt
gacccagccatgcgccttatcctggaacagatgcagaaggacccccaggcactcagcgaa
cacttaaagaatcctgtaatagcacagaagatccagaagctgatggatgtgggtctgatt
gcaattcggtga

DBGET integrated database retrieval system