KEGG   Homo sapiens (human): 10965
Entry
10965             CDS       T01001                                 
Symbol
ACOT2, CTE-IA, CTE1A, MTE1, PTE2, PTE2A, ZAP128
Name
(RefSeq) acyl-CoA thioesterase 2
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    10965 (ACOT2)
   01040 Biosynthesis of unsaturated fatty acids
    10965 (ACOT2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    10965 (ACOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    10965 (ACOT2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     10965 (ACOT2)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   10965 (ACOT2)
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH Peptidase_S9 FSH1
Other DBs
NCBI-GeneID: 10965
NCBI-ProteinID: NP_006812
OMIM: 609972
HGNC: 18431
Ensembl: ENSG00000119673
Pharos: P49753(Tbio)
UniProt: P49753
Structure
Position
14:73567620..73575658
AA seq 483 aa
MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVP
ARMAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLG
ELDLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGR
LLCQTRHERYFLPPGVRREPVRVGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLL
AGKGFAVMALAYYNYEDLPKTMETLHLEYFEEAMNYLLSHPEVKGPGVGLLGISKGGELC
LSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDGYADIVDVLNS
PLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPET
GHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIP
SKV
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtctaacaagcttctttctccccacccccattcagttgttctcaggtctgaattcaaa
atggcctcatctcctgctgtccttcgagcgtcccggctgtaccaatggagcctgaagagt
tcggcgcagttcctggggtctccacagctgaggcaggttggtcagatcattagggttcct
gctcggatggcggcgacgctgatcctggagcctgcgggccgctgctgctgggacgaaccg
gtgcgaatcgccgtgcgcggcctagccccggagcagccggtcacgctgcgcgcgtccctg
cgcgacgagaagggcgcgcttttccaggcccacgcgcgctaccgcgccgacactcttggc
gagctggacctggagcgcgcgcccgcgctgggcggcagcttcgcggggcttgagcccatg
gggctgctctgggccttggagcccgagaaacctttggtgcggctggtgaagcgcgacgtg
cgaacgcccttggccgtggagctggaggtgctggatggccacgaccccgaccccgggcgg
ctgctgtgccagacgcggcacgagcgctacttcctcccgcccggggtgcggcgcgagccg
gtgcgcgtgggccgggtgcgaggcacgctcttcctgccgccagaacctgggccctttcct
gggattgtggacatgttcggaactggaggtggcctgctggagtatcgggctagtctgctg
gctgggaagggttttgctgtgatggctctggcttattataactatgaagacctccccaag
accatggagacgctccatctggagtactttgaagaagccatgaactacttgctcagtcat
cccgaggtaaaaggtccaggagttgggctgcttggaatttccaaagggggtgagctctgc
ctttccatggcctctttcctgaagggcatcacggctgctgtcgtcatcaacggctctgtg
gccaatgttgggggaaccttacactacaagggcgagaccctgccccctgtgggcgtcaac
agaaatcgcatcaaggtgaccaaagatggctatgcagacattgtggatgtcctgaacagc
cctttggaaggacctgaccagaagagcttcattcctgtggaaagggcagagagcaccttc
ctgttcctggtaggtcaggatgaccacaactggaagagtgagttctatgctaatgaggcc
tgtaaacgcttgcaggcccatgggaggagaaagccccagatcatctgttacccagagaca
gggcactatattgagcctccttacttccccctgtgtcgggcttccctgcatgccttggtg
ggcagtcctattatctggggaggggagcccagggctcatgccatggctcaggtggatgct
tggaaacaactccagactttcttccacaaacacttgggtggccacgaggggacaatccca
tcaaaagtgtaa

DBGET integrated database retrieval system