KEGG   Homo sapiens (human): 10970
Entry
10970             CDS       T01001                                 

Symbol
CKAP4, CLIMP-63, CLIMP63, ERGIC-63, p63
Name
(RefSeq) cytoskeleton associated protein 4
  KO
K13999  cytoskeleton-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10970 (CKAP4)
SSDB
Motif
Pfam: Crescentin Syntaxin-6_N Fez1 DUF4200 T2SS_PulS_OutS Jnk-SapK_ap_N TRAF_BIRC3_bd Spc7 DUF5847 FPP DUF1180 DUF2312 NPV_P10
Other DBs
NCBI-GeneID: 10970
NCBI-ProteinID: NP_006816
OMIM: 618595
HGNC: 16991
Ensembl: ENSG00000136026
Vega: OTTHUMG00000170085
Pharos: Q07065(Tbio)
UniProt: Q07065 A0A024RBH2
Position
12q23.3
AA seq 602 aa
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQPPPPPAPHPQQHPQQHPQ
NQAHGKGGHRGGGGGGGKSSSSSSASAAAAAAAASSSASCSRRLGRALNFLFYLALVAAA
AFSGWCVHHVLEEVQQVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESILRSSQ
HKQDLTEKAVKQGESEVSRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEER
LTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSA
KSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSE
ESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGV
LSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQL
VLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLK
ASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHE
KV
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccctcggccaaacaaaggggctccaagggcggccacggcgccgcgagcccctcggag
aagggtgcccacccgtcgggcggcgcggatgacgtggcgaagaagccgccgccggcgccg
cagcagccgccgccgccgcccgcgccgcacccgcagcagcacccgcagcagcacccgcag
aaccaggcgcacggcaagggcggccaccgcggcggcggcggcggcggcggcaagtcctcc
tcctcctcctccgcctccgccgccgctgccgccgccgccgcctcgtcctcggcgtcctgc
tcgcgcaggctcggcagggcgctcaactttctcttctacctcgccctggtggcggcggcc
gctttctcgggctggtgcgtccaccacgtcctggaggaggtccagcaggtccggcgcagc
caccaggacttctcccggcagagggaggagctgggccagggcttgcagggcgtcgagcag
aaggtgcagtctttgcaagccacatttggaacttttgagtccatcttgagaagctcccaa
cataaacaagacctcacagagaaagctgtgaagcaaggggagagtgaggtcagccggatc
agcgaagtgctgcagaaactccagaatgagattctcaaagacctctcggatgggatccat
gtggtgaaggacgcccgggagcgggacttcacgtccctggagaacacggtggaggagcgg
ctgacggagctcaccaaatccatcaacgacaacatcgccatcttcacagaagtccagaag
aggagccagaaggagatcaatgacatgaaggcaaaggttgcctccctggaagaatctgag
gggaacaagcaggatttgaaagccttaaaggaagctgtgaaggagatacagacctcagcc
aagtccagagagtgggacatggaggccctgagaagtacccttcagactatggagtctgac
atctacaccgaggtccgcgagctggtgagcctcaagcaggagcagcaggctttcaaggag
gcggccgacacggagcggctcgccctgcaggccctcacggagaagcttctcaggtctgag
gagtccgtctcccgcctcccggaggagatccggagactggaggaagagctccgccagctg
aagtccgattcccacgggccgaaggaggacggaggcttcagacactcggaagcctttgag
gcactccagcaaaagagtcagggactggactccaggctccagcacgtggaggatggggtg
ctctccatgcaggtggcttctgcgcgccagaccgagagcctggagtccctcctgtccaag
agccaggagcacgagcagcgcctggccgccctgcaggggcgcctggaaggcctcgggtcc
tcagaggcagaccaggatggcctggccagcacggtgaggagcctgggcgagacccagctg
gtgctctacggtgacgtggaggagctgaagaggagtgtgggcgagctccccagcaccgtg
gaatcactccagaaggtgcaggagcaggtgcacacgctgctcagtcaggaccaagcccag
gccgcccgtctgcctcctcaggacttcctggacagactttcttctctagacaacctgaaa
gcctcagtcagccaagtggaggcggacttgaaaatgctcaggactgctgtggacagtttg
gttgcatactcggtcaaaatagaaaccaacgagaacaatctggaatcagccaagggttta
ctagatgacctgaggaatgatctggataggttgtttgtgaaagtggagaagattcacgaa
aaggtctaa

DBGET integrated database retrieval system