KEGG   Homo sapiens (human): 10971Help
Entry
10971             CDS       T01001                                 

Gene name
YWHAQ, 14-3-3, 1C5, HS1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    10971 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    10971 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10971 (YWHAQ)
   04114 Oocyte meiosis
    10971 (YWHAQ)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    10971 (YWHAQ)
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    10971 (YWHAQ)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    10971 (YWHAQ)
   05160 Hepatitis C
    10971 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10971 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10971 (YWHAQ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    10971 (YWHAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10971 (YWHAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM
Motif
Other DBs
NCBI-GeneID: 10971
NCBI-ProteinID: NP_006817
OMIM: 609009
HGNC: 12854
Ensembl: ENSG00000134308
Vega: OTTHUMG00000013848
Pharos: P27348(Tbio)
UniProt: P27348
Structure
PDB: 

Position
2p25.1
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtgctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggtgattacttccggtaccttgctgaagttgcgtgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgag
attcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccatt
gctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggctgaaaactaa

DBGET integrated database retrieval system