KEGG   Homo sapiens (human): 10972
Entry
10972             CDS       T01001                                 

Symbol
TMED10, P24(DELTA), S31I125, S31III125, TMP21, Tmp-21-I, p23, p24d1
Name
(RefSeq) transmembrane p24 trafficking protein 10
  KO
K20352  p24 family protein delta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
N01294  Escherichia NleF to COPI vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10972 (TMED10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10972 (TMED10)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    10972 (TMED10)
SSDB
Motif
Pfam: EMP24_GP25L
Other DBs
NCBI-GeneID: 10972
NCBI-ProteinID: NP_006818
OMIM: 605406
HGNC: 16998
Ensembl: ENSG00000170348
Vega: OTTHUMG00000171771
Pharos: P49755(Tbio)
UniProt: P49755 A0A024R6I3
Position
14q24.3
AA seq 219 aa
MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEI
SDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQ
LVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNE
STNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtctggtttgtctggcccaccagcccggcgcggcccttttccgttagcgttgctgctt
ttgttcctgctcggccccagattggtccttgccatctccttccatctgcccattaactct
cgcaagtgcctccgtgaggagattcacaaggacctgctagtgactggcgcgtacgagatc
tccgaccagtctgggggcgctggcggcctgcgcagccacctcaagatcacagattctgct
ggccatattctctactccaaagaggatgcaaccaaggggaaatttgcctttaccactgaa
gattatgacatgtttgaagtgtgttttgagagcaagggaacagggcggatacctgaccaa
ctcgtgatcctagacatgaagcatggagtggaggcgaaaaattacgaagagattgcaaaa
gttgagaagctcaaaccattagaggtagagctgcgacgcctagaagacctttcagaatct
attgttaatgattttgcctacatgaagaagagagaagaggagatgcgtgataccaacgag
tcaacaaacactcgggtcctatacttcagcatcttttcaatgttctgtctcattggacta
gctacctggcaggtcttctacctgcgacgcttcttcaaggccaagaaattgattgagtaa

DBGET integrated database retrieval system