KEGG   Homo sapiens (human): 10975Help
Entry
10975             CDS       T01001                                 

Gene name
UQCR11, 0710008D09Rik, QCR10, UQCR
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10975 (UQCR11)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    10975 (UQCR11)
  09159 Environmental adaptation
   04714 Thermogenesis
    10975 (UQCR11)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    10975 (UQCR11)
   05012 Parkinson disease
    10975 (UQCR11)
   05016 Huntington disease
    10975 (UQCR11)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10975 (UQCR11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_6-4kD QCR10
Motif
Other DBs
NCBI-GeneID: 10975
NCBI-ProteinID: NP_006821
OMIM: 609711
HGNC: 30862
Ensembl: ENSG00000127540
Vega: OTTHUMG00000180084
Pharos: O14957(Tdark)
UniProt: O14957
Structure
PDB: 

Position
19p13.3
AA seq 56 aa AA seqDB search
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggtgacccggttcctgggcccacgctaccgggagctggtcaagaactgggtcccgacg
gcctacacatggggcgctgtgggcgccgtggggctggtgtgggccaccgattggcggctg
atcctggactgggtaccttacatcaatggcaagtttaagaaggataattaa

KEGG   Homo sapiens (human): 1537Help
Entry
1537              CDS       T01001                                 

Gene name
CYC1, MC3DN6, UQCR4
Definition
(RefSeq) cytochrome c1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1537 (CYC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1537 (CYC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1537 (CYC1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    1537 (CYC1)
   05012 Parkinson disease
    1537 (CYC1)
   05016 Huntington disease
    1537 (CYC1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1537 (CYC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 1537
NCBI-ProteinID: NP_001907
OMIM: 123980
HGNC: 2579
Ensembl: ENSG00000179091
Vega: OTTHUMG00000165242
Pharos: P08574(Tbio)
UniProt: P08574
Structure
PDB: 

Position
8q24.3
AA seq 325 aa AA seqDB search
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgcggcttcgcttcgcggggtagtgttgggcccgcggggcgcggggctc
ccgggcgcgcgtgcccggggtctgctgtgcagcgcgcgtcccgggcagctcccgctacgg
acacctcaggcagtggccttgtcgtcgaagtctggcctttcccgaggccggaaagtgatg
ctgtcagcgctgggcatgctggcggcagggggtgcggggctggccgtggctctgcattcg
gctgtgagtgccagtgacctggagctgcacccccccagctatccgtggtctcaccgtggc
ctcctctcttccttggaccacaccagcatccggaggggtttccaggtatataagcaggtg
tgcgcctcctgccacagcatggacttcgtggcctaccgccacctggtgggcgtgtgctac
acggaggatgaagctaaggagctggctgcggaggtggaggttcaagacggccccaatgaa
gatggggagatgttcatgcggccagggaagctgttcgactatttcccaaaaccatacccc
aacagtgaggctgctcgagctgccaacaacggagcattgccccctgacctcagctacatc
gtgcgagctaggcatggtggtgaggactacgtcttctccctgctcacgggctactgcgag
ccacccaccggggtgtcactgcgggaaggtctctacttcaacccctactttcctggccag
gccattgccatggcccctcccatctacacagatgtcttagagtttgacgatggcacccca
gctaccatgtcccagatagccaaggatgtgtgcaccttcctgcgctgggcatctgagcca
gagcacgaccatcgaaaacgcatggggctcaagatgttgatgatgatggctctgctggtg
cccctggtctacaccataaagcggcacaagtggtcagtcctgaagagtcggaagctggca
tatcggccgcccaagtga

KEGG   Homo sapiens (human): 27089Help
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
(RefSeq) ubiquinol-cytochrome c reductase complex III subunit VII
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    27089 (UQCRQ)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    27089 (UQCRQ)
  09159 Environmental adaptation
   04714 Thermogenesis
    27089 (UQCRQ)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    27089 (UQCRQ)
   05012 Parkinson disease
    27089 (UQCRQ)
   05016 Huntington disease
    27089 (UQCRQ)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    27089 (UQCRQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UcrQ Cyt_b-c1_8
Motif
Other DBs
NCBI-GeneID: 27089
NCBI-ProteinID: NP_055217
OMIM: 612080
HGNC: 29594
Ensembl: ENSG00000164405
Vega: OTTHUMG00000059836
Pharos: O14949(Tbio)
UniProt: O14949
Structure
PDB: 

Position
5q31.1
AA seq 82 aa AA seqDB search
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

KEGG   Homo sapiens (human): 29796Help
Entry
29796             CDS       T01001                                 

Gene name
UQCR10, HSPC051, HSPC119, HSPC151, QCR9, UCCR7.2, UCRC
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29796 (UQCR10)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29796 (UQCR10)
  09159 Environmental adaptation
   04714 Thermogenesis
    29796 (UQCR10)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    29796 (UQCR10)
   05012 Parkinson disease
    29796 (UQCR10)
   05016 Huntington disease
    29796 (UQCR10)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29796 (UQCR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-GeneID: 29796
NCBI-ProteinID: NP_037519
OMIM: 610843
HGNC: 30863
Ensembl: ENSG00000184076
Vega: OTTHUMG00000151283
Pharos: Q9UDW1(Tdark)
UniProt: Q9UDW1
Structure
PDB: 

Position
22q12.2
AA seq 63 aa AA seqDB search
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgacgttgacttcgaaattgtactccctgctgttccgcaggacctccacc
ttcgccctcaccatcatcgtgggcgtcatgttcttcgagcgcgccttcgatcaaggcgcg
gacgctatctacgaccacatcaacgaggggaagctgtggaaacacatcaagcacaagtat
gagaacaagtag

KEGG   Homo sapiens (human): 440567Help
Entry
440567            CDS       T01001                                 

Gene name
UQCRHL
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein like
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    440567 (UQCRHL)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    440567 (UQCRHL)
  09159 Environmental adaptation
   04714 Thermogenesis
    440567 (UQCRHL)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    440567 (UQCRHL)
   05012 Parkinson disease
    440567 (UQCRHL)
   05016 Huntington disease
    440567 (UQCRHL)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    440567 (UQCRHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_hinge Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 440567
NCBI-ProteinID: NP_001083060
HGNC: 51714
Ensembl: ENSG00000233954
Vega: OTTHUMG00000003109
UniProt: A0A096LP55
Position
1p36.21
AA seq 91 aa AA seqDB search
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctatgatgagcatgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcaaaggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

KEGG   Homo sapiens (human): 4519Help
Entry
4519              CDS       T01001                                 

Gene name
CYTB, MTCYB, MT-CYB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Disease
H00068  Leber hereditary optic atrophy (LHON)
H01355  Kearns-Sayre syndrome
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4519 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4519 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    4519 (CYTB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4519 (CYTB)
   05012 Parkinson disease
    4519 (CYTB)
   05016 Huntington disease
    4519 (CYTB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4519 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4519 (CYTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    4519 (CYTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Motif
Other DBs
NCBI-GeneID: 4519
NCBI-ProteinID: YP_003024038
OMIM: 516020
HGNC: 7427
Pharos: P00156(Tbio)
UniProt: P00156 Q0ZFD6
Structure
PDB: 

Position
MT
AA seq 380 aa AA seqDB search
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
NT seq 1141 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatacgcaaaactaaccccctaataaaattaattaaccactcattcatcgac
ctccccaccccatccaacatctccgcatgatgaaacttcggctcactccttggcgcctgc
ctgatcctccaaatcaccacaggactattcctagccatgcactactcaccagacgcctca
accgccttttcatcaatcgcccacatcactcgagacgtaaattatggctgaatcatccgc
taccttcacgccaatggcgcctcaatattctttatctgcctcttcctacacatcgggcga
ggcctatattacggatcatttctctactcagaaacctgaaacatcggcattatcctcctg
cttgcaactatagcaacagccttcataggctatgtcctcccgtgaggccaaatatcattc
tgaggggccacagtaattacaaacttactatccgccatcccatacattgggacagaccta
gttcaatgaatctgaggaggctactcagtagacagtcccaccctcacacgattctttacc
tttcacttcatcttgcccttcattattgcagccctagcaacactccacctcctattcttg
cacgaaacgggatcaaacaaccccctaggaatcacctcccattccgataaaatcaccttc
cacccttactacacaatcaaagacgccctcggcttacttctcttccttctctccttaatg
acattaacactattctcaccagacctcctaggcgacccagacaattataccctagccaac
cccttaaacacccctccccacatcaagcccgaatgatatttcctattcgcctacacaatt
ctccgatccgtccctaacaaactaggaggcgtccttgccctattactatccatcctcatc
ctagcaataatccccatcctccatatatccaaacaacaaagcataatatttcgcccacta
agccaatcactttattgactcctagccgcagacctcctcattctaacctgaatcggagga
caaccagtaagctacccttttaccatcattggacaagtagcatccgtactatacttcaca
acaatcctaatcctaataccaactatctccctaattgaaaacaaaatactcaaatgggcc
t

KEGG   Homo sapiens (human): 7381Help
Entry
7381              CDS       T01001                                 

Gene name
UQCRB, MC3DN3, QCR7, QP-C, QPC, UQBC, UQBP, UQCR6, UQPC
Definition
(RefSeq) ubiquinol-cytochrome c reductase binding protein
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7381 (UQCRB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7381 (UQCRB)
  09159 Environmental adaptation
   04714 Thermogenesis
    7381 (UQCRB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7381 (UQCRB)
   05012 Parkinson disease
    7381 (UQCRB)
   05016 Huntington disease
    7381 (UQCRB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7381 (UQCRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_14kD
Motif
Other DBs
NCBI-GeneID: 7381
NCBI-ProteinID: NP_006285
OMIM: 191330
HGNC: 12582
Ensembl: ENSG00000156467
Vega: OTTHUMG00000164711
Pharos: P14927(Tbio)
UniProt: P14927
Structure
PDB: 

Position
8q22.1
AA seq 111 aa AA seqDB search
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggctggtaagcaggccgtttcagcatcaggcaagtggctggatggtattcgaaaatgg
tattacaatgctgcaggattcaataaactggggttaatgcgagatgatacaatatacgag
gatgaagatgtaaaagaagccataagaagacttcctgagaacctttataatgacaggatg
tttcgcattaagagggcactggacctgaacttgaagcatcagatcttgcctaaagagcag
tggaccaaatatgaagaggaaaatttctaccttgaaccgtatctgaaagaggttattcgg
gaaagaaaagaaagagaagaatgggcaaagaagtaa

KEGG   Homo sapiens (human): 7384Help
Entry
7384              CDS       T01001                                 

Gene name
UQCRC1, D3S3191, QCR1, UQCR1
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7384 (UQCRC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7384 (UQCRC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7384 (UQCRC1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7384 (UQCRC1)
   05012 Parkinson disease
    7384 (UQCRC1)
   05016 Huntington disease
    7384 (UQCRC1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7384 (UQCRC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    7384 (UQCRC1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   7384 (UQCRC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Motif
Other DBs
NCBI-GeneID: 7384
NCBI-ProteinID: NP_003356
OMIM: 191328
HGNC: 12585
Ensembl: ENSG00000010256
Vega: OTTHUMG00000133539
Pharos: P31930(Tbio)
UniProt: P31930
Structure
PDB: 

Position
3p21.31
AA seq 480 aa AA seqDB search
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgtggtctgtcgggccgctaccgccggggcacaagtgctattgcgcgcc
cgccgctcgccggccctgctgcggacgccagccttgcggagtacggcaaccttcgctcag
gcgctccagttcgtgccggagacgcaggttagcctgctggacaacggcctgcgtgtggcc
tccgagcagtcctctcagcccacttgcacggtgggagtgtggattgatgttggcagccgt
tttgagactgagaagaataatggggcaggctactttttggagcatctggctttcaaggga
acaaagaatcggcctggcagtgccctggagaaggaggtggagagcatgggggcccatctt
aatgcctacagcacccgggagcacacagcttactacatcaaggcgctgtccaaggatctg
ccgaaagctgtggagctcctgggtgacattgtgcagaactgtagtctggaagactcacag
attgagaaggaacgtgatgtgatcctgcgggagatgcaggagaatgatgcatctatgcga
gatgtggtctttaactacctgcatgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaatgtcaggaagctgtctcgtgcagacttgaccgagtacctc
agcacacattacaaggcccctcgaatggtgctggcagcagctggaggagtggagcaccag
caactgttagacctcgcccagaagcacctcggtggcatcccatggacatatgcagaggac
gctgtgcccactcttactccatgccgcttcactggcagtgagatccgccaccgtgatgat
gctctaccttttgcccacgtggccattgcagtagagggtcctggctgggccagcccggac
aatgtggccttgcaagtggccaatgccatcatcggccactatgactgcacttatggtggt
ggcgtgcacctgtccagcccactggcttcaggtgctgtggccaacaagctatgccagagt
ttccagaccttcagcatctgctatgcagagacgggcttgctgggtgcacactttgtctgt
gaccgaatgaaaatcgatgacatgatgttcgtcctgcaagggcagtggatgcgcctgtgt
accagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccctggta
tctcatctagatggcactactcctgtgtgtgaggacatcggacgcagcctcctgacctat
ggccgccgcatccccctggctgaatgggaaagccggattgcggaggtggatgccagtgtg
gtacgtgagatctgctccaagtacatctatgaccagtgcccagcagtggctggatatggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgcttc
tag

KEGG   Homo sapiens (human): 7385Help
Entry
7385              CDS       T01001                                 

Gene name
UQCRC2, MC3DN5, QCR2, UQCR2
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 2
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7385 (UQCRC2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7385 (UQCRC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    7385 (UQCRC2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7385 (UQCRC2)
   05012 Parkinson disease
    7385 (UQCRC2)
   05016 Huntington disease
    7385 (UQCRC2)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7385 (UQCRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    7385 (UQCRC2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   7385 (UQCRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C DUF1471
Motif
Other DBs
NCBI-GeneID: 7385
NCBI-ProteinID: NP_003357
OMIM: 191329
HGNC: 12586
Ensembl: ENSG00000140740
Vega: OTTHUMG00000131585
Pharos: P22695(Tbio)
UniProt: P22695
Structure
PDB: 

Position
16p12.2
AA seq 453 aa AA seqDB search
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSR
IGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAA
AYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK
RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKT
IAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagctactaaccagagccggctctttctcgagattttattccctcaaagttgccccc
aaagttaaagccacagctgcgcctgcaggagcaccgccacaacctcaggaccttgagttt
accaagttaccaaatggcttggtgattgcttctttggaaaactattctcctgtatcaaga
attggtttgttcattaaagcaggcagtagatatgaggacttcagcaatttaggaaccacc
catttgctgcgtcttacatccagtctgacgacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggcaaattaagtgtgaccgcaacaagggaaaacatggct
tatactgtggaatgcctgcggggtgatgttgatattctaatggagttcctgctcaatgtc
accacagcaccagaatttcgtcgttgggaagtagctgaccttcagcctcagctaaagatt
gacaaagctgtggcctttcagaatccgcagactcatgtcattgaaaatttgcatgcagca
gcttaccggaatgccttggctaatcccttgtattgtcctgactataggattggaaaagtg
acatcagaggagttacattacttcgttcagaaccatttcacaagtgcaagaatggctttg
attggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttatctggtgcaaaggccaactaccgtggaggtgaaatccgagaa
cagaatggagacagtcttgtccatgctgcttttgtagcagaaagtgctgtcgcgggaagt
gcagaggcaaatgcatttagtgttcttcagcatgtcctcggtgctgggccacatgtcaag
aggggcagcaacaccaccagccatctgcaccaggctgttgccaaggcaactcagcagcca
tttgatgtttctgcatttaatgccagttactcagattctggactctttgggatttatact
atctcccaggccacagctgctggagatgttatcaaggctgcctataatcaagtaaaaaca
atagctcaaggaaacctttccaacacagatgtccaagctgccaagaacaagctgaaagct
ggatacctaatgtcagtggagtcttctgagtgtttcctggaagaagtcgggtcccaggct
ctagttgctggttcttacatgccaccatccacagtccttcagcagattgattcagtggct
aatgctgatatcataaatgcggcaaagaagtttgtttctggccagaagtcaatggcagca
agtggaaatttgggacatacaccttttgttgatgagttgtaa

KEGG   Homo sapiens (human): 7386Help
Entry
7386              CDS       T01001                                 

Gene name
UQCRFS1, RIP1, RIS1, RISP, UQCR5
Definition
(RefSeq) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7386 (UQCRFS1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7386 (UQCRFS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7386 (UQCRFS1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7386 (UQCRFS1)
   05012 Parkinson disease
    7386 (UQCRFS1)
   05016 Huntington disease
    7386 (UQCRFS1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7386 (UQCRFS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.2  With a cytochrome as acceptor
    1.10.2.2  quinol---cytochrome-c reductase
     7386 (UQCRFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske TPK_B1_binding
Motif
Other DBs
NCBI-GeneID: 7386
NCBI-ProteinID: NP_005994
OMIM: 191327
HGNC: 12587
Ensembl: ENSG00000169021
Vega: OTTHUMG00000181997
Pharos: P47985(Tbio)
UniProt: P47985
Structure
PDB: 

Position
19q12
AA seq 274 aa AA seqDB search
MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtagcatcccgctcaggcccgttcgcgcccgtcctgtcggccacgtcccgc
ggggtggcgggcgcgctgcggcccttggtgcaggccacggtgcccgccaccccggagcag
cctgtgttggacctgaagcggcccttcctcagccgggagtcgctgagcggccaggccgtg
cgccggcctttggtcgcctccgtgggcctcaatgtccctgcttctgtttgttattcccac
acagacatcaaggtgcctgacttctctgaataccgccgccttgaagttttagatagtacg
aagtcttcaagagaaagcagcgaggctaggaaaggtttctcctatttggtaactggagta
actactgtgggtgtcgcatatgctgccaagaatgccgtcacccagttcgtttccagcatg
agtgcttctgctgatgtgttggccctggcgaaaatcgaaatcaagttatccgatattcca
gaaggcaagaacatggctttcaaatggagaggcaaacccctgtttgtgcgtcatagaacc
cagaaggaaattgagcaggaagctgcagttgaattatcacagttgagggacccacagcat
gatctagatcgagtaaagaaacctgaatgggttatcctgataggtgtttgcactcatctt
ggctgtgtacccattgcaaatgcaggagattttggtggttattactgcccttgccatggg
tcacactatgatgcatctggcaggatcagattgggtcctgctcctctcaaccttgaagtc
cccacgtatgagttcaccagtgacgatatggtgattgttggttaa

KEGG   Homo sapiens (human): 7388Help
Entry
7388              CDS       T01001                                 

Gene name
UQCRH, QCR6, UQCR8
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7388 (UQCRH)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7388 (UQCRH)
  09159 Environmental adaptation
   04714 Thermogenesis
    7388 (UQCRH)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7388 (UQCRH)
   05012 Parkinson disease
    7388 (UQCRH)
   05016 Huntington disease
    7388 (UQCRH)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7388 (UQCRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_hinge Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 7388
NCBI-ProteinID: NP_005995
OMIM: 613844
HGNC: 12590
Ensembl: ENSG00000173660
Vega: OTTHUMG00000007813
Pharos: P07919(Tdark)
UniProt: P07919
Structure
PDB: 

Position
1p33
AA seq 91 aa AA seqDB search
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SHTEEDCTEELFDFLHARDHCVAHKLFNNLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctgtgatgagcgtgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcgagggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

DBGET integrated database retrieval system