KEGG   Homo sapiens (human): 10978Help
Entry
10978             CDS       T01001                                 

Gene name
CLP1, HEAB, hClp1
Definition
(RefSeq) cleavage and polyadenylation factor I subunit 1
  KO
K14399  polyribonucleotide 5'-hydroxyl-kinase [EC:2.7.1.78]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Disease
H00897  Pontocerebellar hypoplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    10978 (CLP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10978 (CLP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.78  polynucleotide 5'-hydroxyl-kinase
     10978 (CLP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     10978 (CLP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLP1_P CLP1_N Clp1 ATP_bind_1 MMR_HSR1 TniB AAA_18 AAA_22 CbiA AAA_16
Motif
Other DBs
NCBI-GeneID: 10978
NCBI-ProteinID: NP_006822
OMIM: 608757
HGNC: 16999
Ensembl: ENSG00000172409
Vega: OTTHUMG00000167146
Pharos: Q92989(Tbio)
UniProt: Q92989
Position
11q12.1
AA seq 425 aa AA seqDB search
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAG
AKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVV
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI
QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQ
ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRD
MVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR
FMDLK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagaggctaatgatgacaagaagccaaccactaaatttgaactagagcgagaa
acagaacttcgctttgaggtggaggcatctcagtcagttcagttggagttgttgactggc
atggcagagatctttggcacagagctgacccgaaacaagaaattcacctttgatgctggt
gccaaggtggctgttttcacttggcatggctgttctgtgcaactgagcggccgcactgag
gtggcttatgtctccaaggacactcctatgttgctttacctcaacactcacacagccttg
gaacagatgcggaggcaagcggaaaaggaagaagagcgaggtccccgagtgatggtagtg
ggccccactgatgtgggcaagtctacagtgtgtcgccttctgctcaactacgcagtgcgt
ttgggccgccgtcccacttatgtggagctggatgtgggccagggttctgtgtccatccct
ggtaccatgggggccctctacatcgagcggcctgcagatgtcgaagagggtttctctatc
caggcccctctggtgtatcattttggttccaccactcctggcactaacatcaagctttat
aataagattacatctcgtttagcagatgtgttcaaccaaaggtgtgaggtgaaccgaagg
gcatctgtgagtggctgtgtcattaacacctgtggctgggtcaagggctctggttaccag
gctctggtgcatgcagcctcagcttttgaggtggatgtcgttgttgttctggatcaagaa
cgactgtacaatgaactgaaacgggacctcccccactttgtacgcactgtgctgctccct
aaatctgggggtgtggtggagcgctccaaggacttccggcgggaatgtagggatgagcgt
atccgtgagtatttttatggattccgaggctgtttctatccccatgccttcaatgtcaaa
ttttcagatgtgaaaatctacaaagttggggcacccaccatcccagactcctgtttacct
ttgggcatgtctcaagaggataatcagctcaagctagtacctgtcactcctgggcgagat
atggtgcaccacctactgagtgttagcactgccgagggtacagaggagaacctgtccgag
acaagtgtagctggcttcattgtggtgaccagtgtggacctggagcatcaggtgtttact
gttctgtctccagcccctcgcccactgcctaagaacttccttctcatcatggatatccgg
ttcatggatctgaagtag

DBGET integrated database retrieval system