KEGG   Homo sapiens (human): 10980
Entry
10980             CDS       T01001                                 
Symbol
COPS6, CSN6, MOV34-34KD
Name
(RefSeq) COP9 signalosome subunit 6
  KO
K12179  COP9 signalosome complex subunit 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10980 (COPS6)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    10980 (COPS6)
SSDB
Motif
Pfam: MitMem_reg JAB
Other DBs
NCBI-GeneID: 10980
NCBI-ProteinID: NP_006824
OMIM: 614729
HGNC: 21749
Ensembl: ENSG00000168090
Pharos: Q7L5N1(Tbio)
UniProt: Q7L5N1
Structure
Position
7:100088969..100092187
AA seq 327 aa
MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRS
QEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELE
FLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEAT
MLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILE
YVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCN
TMNQFVNKFNVLYDRQGIGRRMRGLFF
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctgcagctacgaacgggaccggaggaagcagcgggatg
gaggtggatgcagcagtagtccccagcgtgatggcctgcggagtgactgggagtgtttcc
gtcgctctccatccccttgtcattctcaacatctcagaccactggatccgcatgcgctcc
caggaggggcggcctgtgcaggtgattggggctctgattggcaagcaggagggccgaaat
atcgaggtgatgaactcctttgagctgctgtcccacaccgtggaagagaagattatcatt
gacaaggaatattattacaccaaggaggagcagtttaaacaggtgttcaaggagctggag
tttctgggttggtataccacaggggggccacctgacccctcggacatccacgtccataag
caggtgtgtgagatcatcgagagccccctctttctgaagttgaaccctatgaccaagcac
acagatcttcctgtcagcgtttttgagtctgtcattgatataatcaatggagaggccaca
atgctgtttgctgagctgacctacactctggccacagaggaagcggaacgcattggtgta
gaccacgtagcccgaatgacagcaacaggcagtggagagaactccactgtggctgaacac
ctgatagcacagcacagcgccatcaagatgctgcacagccgcgtcaagctcatcttggag
tacgtcaaggcctctgaagcgggagaggtcccctttaatcatgagatcctgcgggaggcc
tatgctctgtgtcactgtctcccggtgctcagcacagacaagttcaagacagatttttat
gatcaatgcaacgacgtggggctcatggcctacctcggcaccatcaccaaaacgtgcaac
accatgaaccagtttgtgaacaagttcaatgtcctctacgaccgacaaggcatcggcagg
agaatgcgcgggctctttttctga

DBGET integrated database retrieval system